DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and zgc:113119

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001014315.2 Gene:zgc:113119 / 541480 ZFINID:ZDB-GENE-050327-3 Length:420 Species:Danio rerio


Alignment Length:126 Identity:50/126 - (39%)
Similarity:70/126 - (55%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            ||.|:.|.:||..|:.|..|::|||.:||:.|..|.:.|.:|.|...|.|.||||:|:.|..|.|
Zfish   251 PYICQQCGKSFALKRVLMTHVKIHTRDRPFLCKQCGKCFYRKDNFNRHVRVHTGEKPYACSECGK 315

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQETKRNKFK 339
            .|.:..|...|:|||:|.:.|.|.:|.:.|.:...|::||..||..|.....|..|...||
Zfish   316 SFSERFQFNEHSRTHSGVKRFSCEQCGRGFNRKTELKRHMRVHTGEKPYMCPQCGKTYAFK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 10/24 (42%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zgc:113119NP_001014315.2 C2H2 Zn finger 87..107 CDD:275368
COG5048 <111..262 CDD:227381 5/10 (50%)
C2H2 Zn finger 115..135 CDD:275368
C2H2 Zn finger 143..163 CDD:275368
C2H2 Zn finger 171..191 CDD:275368
C2H2 Zn finger 199..218 CDD:275368
C2H2 Zn finger 226..246 CDD:275368
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
COG5048 277..>417 CDD:227381 38/100 (38%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..330 CDD:275368 7/19 (37%)
C2H2 Zn finger 338..358 CDD:275368 6/19 (32%)
C2H2 Zn finger 366..383 CDD:275368 4/11 (36%)
C2H2 Zn finger 394..414 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.