| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001135777.1 | Gene: | ZNF771 / 51333 | HGNCID: | 29653 | Length: | 317 | Species: | Homo sapiens |
| Alignment Length: | 238 | Identity: | 76/238 - (31%) |
|---|---|---|---|
| Similarity: | 107/238 - (44%) | Gaps: | 43/238 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 109 EPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPH---- 169
Fly 170 --------NKSKRRARSYSD---------NDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRC 217
Fly 218 KLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQ 282
Fly 283 VGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGK 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
| ZNF771 | NP_001135777.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..63 | 15/59 (25%) | |
| COG5048 | <62..221 | CDD:227381 | 56/169 (33%) | ||
| C2H2 Zn finger | 65..85 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 93..113 | CDD:275368 | 5/30 (17%) | ||
| C2H2 Zn finger | 121..141 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 149..169 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 177..197 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 205..225 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 217..242 | CDD:404364 | 6/13 (46%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | |||
| zf-H2C2_2 | 245..269 | CDD:404364 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||