Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013324.1 | Gene: | zgc:113135 / 503712 | ZFINID: | ZDB-GENE-050306-7 | Length: | 323 | Species: | Danio rerio |
Alignment Length: | 217 | Identity: | 76/217 - (35%) |
---|---|---|---|
Similarity: | 106/217 - (48%) | Gaps: | 15/217 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 ETSEPLLVELVQVKYMPPEPKPISSPLPDNNEH---------KLAQSYSPAKTPHNKSKRRARSY 179
Fly 180 SDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYK 244
Fly 245 CSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFK 309
Fly 310 QLNGLQKHMSAHTRGKRRTSSQ 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 17/24 (71%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
zgc:113135 | NP_001013324.1 | C2H2 Zn finger | 79..95 | CDD:275368 | 0/15 (0%) |
C2H2 Zn finger | 103..123 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 115..138 | CDD:290200 | 15/22 (68%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <159..316 | CDD:227381 | 26/59 (44%) | ||
C2H2 Zn finger | 159..179 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 171..196 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 199..222 | CDD:290200 | 7/19 (37%) | ||
C2H2 Zn finger | 215..235 | CDD:275368 | 0/3 (0%) | ||
zf-H2C2_2 | 227..252 | CDD:290200 | |||
C2H2 Zn finger | 243..263 | CDD:275368 | |||
C2H2 Zn finger | 271..291 | CDD:275368 | |||
C2H2 Zn finger | 298..318 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588371 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |