DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG1792

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:369 Identity:86/369 - (23%)
Similarity:138/369 - (37%) Gaps:76/369 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDG--MPQFICVECAEAVRN 70
            |.||   .|.|.|:..  ..||..:|...|:...:...:|..:....|  :|.|||..|...::.
  Fly     4 RNCR---TCGLFIFCS--TPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQT 63

  Fly    71 AYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVS-----------VMEAGKTPE 124
            |...|.:..::.:..::    ...|.:.|...:....:|.::..:           :.|.....|
  Fly    64 AIAFRERVIRTQKTLQE----SPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEE 124

  Fly   125 TSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDS 189
            |.||  .|:.:....|....|.       .|.||.:|.....|.....|....|.:....||..:
  Fly   125 TEEP--YEICEQNEQPQVKVPA-------QEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLT 180

  Fly   190 ELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSF-- 252
            |     |:.:  |.||.:.||   ...|:.|.:.||...|.::|:..|||.:.:.|..|.:.|  
  Fly   181 E-----DEVV--ALKRERRKR---DCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYT 235

  Fly   253 ---------------------------AQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHT 290
                                       ...|.:|.....||..:||.|..|.|.|...|:|:.|.
  Fly   236 ATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHM 300

  Fly   291 RTHTGEQPFKCSKCQQSFKQLNGLQKHMSAH--TRGKRRTSSQE 332
            .:|||.:.|.|..||.||.:    :.|:::|  ::|...|||.:
  Fly   301 LSHTGVRAFHCDSCQVSFVR----RSHLTSHYRSKGHAHTSSAQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 19/81 (23%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 8/53 (15%)
C2H2 Zn finger 245..265 CDD:275368 5/48 (10%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 18/78 (23%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
C2H2 Zn finger 226..243 CDD:275368 3/16 (19%)
C2H2 Zn finger 254..275 CDD:275368 2/20 (10%)
zf-C2H2 281..303 CDD:278523 8/21 (38%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 11/23 (48%)
C2H2 Zn finger 311..329 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.