DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG4854

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:341 Identity:98/341 - (28%)
Similarity:149/341 - (43%) Gaps:58/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRVC----RDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEA 67
            ||:|    :|||                :...||.....::.|:|..:.:....|..||..||..
  Fly    12 CRICLVQPKDES----------------LMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALL 60

  Fly    68 VRNAYRLRRQCRKSHQYFEQLRLM-------------MKELDDIEYCLNIGDNIEPQMPVSVMEA 119
            :|.|.:||..|:::.:..::.:|.             .|:.:..:...|.....:.::....:::
  Fly    61 LRAALKLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDS 125

  Fly   120 -GKTPETSEPLLV---ELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAK-TPHNKSKRRARSY 179
             ..|.|:||.:..   |||.:     || .||:|      .:...|.||.. |..::...:|.|:
  Fly   126 YDVTLESSEDVACSADELVSI-----EP-AISAP------EESVYSLSPKPVTFEDEDSGQAASF 178

  Fly   180 SDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYK 244
            :.|...:..||..     |:.|..|....|:   |:.|::|.:.|.|...|..||..|||.||||
  Fly   179 TCNICNNVYSERV-----KLTNHMKVHSAKK---PHECEICHKRFRQTPQLARHMNTHTGNRPYK 235

  Fly   245 CSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFK 309
            |..|...||.......|.|.||.|||:.|..|.:.|.....|:||.:|||||:||.|..||:||.
  Fly   236 CDYCDSRFADPSTRIKHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFS 300

  Fly   310 QLNGLQKHMSAHTRGK 325
            ||:....|..:|.|.|
  Fly   301 QLHHKNSHEKSHKRTK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 20/84 (24%)
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 10/24 (42%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 15/23 (65%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 13/60 (22%)
C2H2 Zn finger 180..200 CDD:275368 6/24 (25%)
zf-H2C2_2 193..217 CDD:290200 7/26 (27%)
COG5048 201..>258 CDD:227381 23/59 (39%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 12/22 (55%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 251..273 CDD:290200 10/21 (48%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 15/23 (65%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.