DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG4424

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:372 Identity:90/372 - (24%)
Similarity:153/372 - (41%) Gaps:80/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISQMCRVCRDESDC-LLDIYTEPYASSNRVQEQEP---VLATMLRECSGCSVH---KEDGMPQ 58
            :::..:||.|..:.:. ::.|:       ....::.|   .|...:...||..:.   ||:.:|.
  Fly     5 LNMMTLCRTCLQDGEAHMVSIF-------QTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPT 62

  Fly    59 FICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPV--------- 114
            .||:.|...:..|::.|:.|::|:::..:  .::|:..:......:.....|..|.         
  Fly    63 RICLRCKAFLTLAHKFRQICQRSNEFLRE--YVIKDAVEQGVVKEVVQQTRPSTPPPIETEQLEP 125

  Fly   115 ---SVMEAG---------KTP----ETSEP--LLVELVQVKYMPPEPKPISSPLPDNNEHKLAQS 161
               .|:|.|         :||    |...|  |.||::...|.||...|                
  Fly   126 PEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLTVEMLPAPYPPPASTP---------------- 174

  Fly   162 YSPAKTPHNKSKRRARSYSDND---SWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQS 223
             .||.....|.|....:...|.   ..:.|:.:...:|::               ||.|::|.:|
  Fly   175 -PPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDER---------------PYECEICHKS 223

  Fly   224 FTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQV 288
            |.....|:.|:|.|||.:||.|..|.|:||.:.:|..|.|.|..|||:.|..|.|:|.....|::
  Fly   224 FHVNYQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKM 288

  Fly   289 HTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSA--HTRGKRRTSSQET 333
            |.:|||||:|..|..|.:||.:::.|..|:..  |....|.|:...|
  Fly   289 HYKTHTGEKPHICQLCNKSFARIHNLVAHLQTQQHINDPRLTAYLST 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 18/88 (20%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 12/24 (50%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 6/21 (29%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 18/90 (20%)
C2H2 Zn finger 189..209 CDD:275368 2/19 (11%)
DUF45 <204..281 CDD:302795 30/91 (33%)
COG5048 210..>345 CDD:227381 49/141 (35%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..320 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.