DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG14711

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:374 Identity:99/374 - (26%)
Similarity:156/374 - (41%) Gaps:75/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCRVCRDESDCLLDIYTE---PYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEA 67
            :||:|..|     ||.:|   |....|..|.:|  |...:.|.....:.....:|..:|..|.|.
  Fly     6 LCRICLTE-----DINSEAMAPLFDDNDAQCRE--LVRKIEEVGSIKLVPLQNIPSMLCYSCVER 63

  Fly    68 VRNAYRLRRQCRKSHQYF--EQLRLMMKE----------LDDIEYCL------------NIG-DN 107
            :.:|::.|..|::|.:.|  ..::..||.          .|:|||..            :|| :|
  Fly    64 LTSAHKFRELCQESERTFATNVVKAEMKSEPTDEVPHVVADNIEYIYESANDFIDGVEDDIGMEN 128

  Fly   108 I-EPQMPVSVMEAGKTPETS--------EPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYS 163
            | |..:...|.|..:..|||        :.|||        |........|:....:.|:.::..
  Fly   129 IMEEPLEDGVGETSQAYETSTVVDDLDEDDLLV--------PNSTDSDYQPIERCRKAKVRKTRM 185

  Fly   164 PAK---TPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNA-----------SKRG------KP 208
            ..:   .|...|....||:|:.   .|..:...:...::.:.           |||.      :.
  Fly   186 TKRGRGRPRGASSGHPRSFSEE---RPPVQASFKSSPEVSSTNIMCEICGNIYSKRAALNIHMRR 247

  Fly   209 KRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGC 273
            .....|::|::|::||.....|..|:|:||||:|:.|..|.||||.:.:...|.|.||.||||.|
  Fly   248 HMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTC 312

  Fly   274 PNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHT 322
            ..|.|.|.....|:.|..|||||:||.|..|.::|.:.:.|.:|:...|
  Fly   313 STCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 22/86 (26%)
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 21/81 (26%)
C2H2 Zn finger 228..248 CDD:275368 3/19 (16%)
zf-H2C2_2 240..264 CDD:290200 4/23 (17%)
COG5048 249..>362 CDD:227381 46/113 (41%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 12/23 (52%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 340..362 CDD:275368 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.