DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG8159

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:336 Identity:91/336 - (27%)
Similarity:150/336 - (44%) Gaps:47/336 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISQMCRVCRDESD--CLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECA 65
            :..:||||...:|  ..|.::.   :.:.:|.:|..:|..:|.:|       |.|:|.::|..|.
  Fly     2 LQNVCRVCASSTDNSKSLKLFN---SGACKVLQQINLLTGVLLQC-------EPGLPDWMCETCQ 56

  Fly    66 EAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLL 130
            ..:::|...|.:|.:|.:.||: .|:..|.|.....:......:.|.....  |.|||.:...::
  Fly    57 TDLKSAISFRDRCLRSQKIFEE-SLVRNEEDTFRSSVRRSARSQRQRHEDT--APKTPASPLEVM 118

  Fly   131 VELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHED 195
            ::|..:.....|...|.. |...||..:..:.          |..:.|..|:.:.||        
  Fly   119 IKLESLSNGDEEDDGIDH-LDSCNEADMELAI----------KAMSSSTEDDGTTSP-------- 164

  Fly   196 DDKIWNASKRGKPKRVPGPYR---------CKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRS 251
             .::....:||..|...|..|         |..|..:.|.|.:.:.|:|.|:|.||::|.|||..
  Fly   165 -VRLKRTRRRGLKKGGKGENRTKVTLPVFFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPAR 228

  Fly   252 FAQKGNLQSHTRCHTGERPFGCPNCPKRF-RQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQ 315
            |...|.|:.|...|||:|.|.|..|.:.: ...|:|: |.||||.::||.|::|.:||.....|:
  Fly   229 FLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLR-HERTHTNDRPFICAQCGKSFTNSYILK 292

  Fly   316 KHMSAHTRGKR 326
            .||..|| |:|
  Fly   293 NHMLIHT-GER 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 22/83 (27%)
zf-C2H2 215..237 CDD:278523 7/30 (23%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 9/25 (36%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 21/82 (26%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
COG5048 <197..322 CDD:227381 44/108 (41%)
zf-H2C2_2 206..231 CDD:290200 11/24 (46%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 6/20 (30%)
zf-H2C2_2 265..287 CDD:290200 11/22 (50%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 7/13 (54%)
C2H2 Zn finger 306..328 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.