DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and Zif

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:393 Identity:89/393 - (22%)
Similarity:146/393 - (37%) Gaps:106/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QMCRVCRDESDCL--LD-IYTEPYASSNRVQEQEPVLATMLRECSGCS---VHKEDGMPQFICVE 63
            |.||||..:|:.|  || |..|...|.|.          ||.:..|.|   ::..:.:|..||..
  Fly     8 QTCRVCLAQSERLQRLDEIREEGEESPNE----------MLIQLLGVSYSNLNDREHIPDGICKS 62

  Fly    64 CAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEP 128
            |...:..||:.|.            :.:.|:::..|||..:|...|..:.:...|.|...:..|.
  Fly    63 CKVELNMAYQFRE------------KALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEE 115

  Fly   129 LLV-------------ELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSK-----RR 175
            :.:             |....:|:..:.......:.|..|: |..:|:   ...|..:     ..
  Fly   116 MYILEETTTGEEEHQEEKGHEEYLEVDTSDQQECIGDTIEY-LEDNYT---IEMNSDQTEIVLES 176

  Fly   176 ARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKR-------------------VPG-------- 213
            .:.|.:    :|..:|..::..|....::||:.:|                   |.|        
  Fly   177 EKQYEE----TPSQQLALQEAAKASLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGR 237

  Fly   214 ------------PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHT 266
                        .|.|:||...|..::.|..||..|||.:|||||.|.|.|..:..|:||...|.
  Fly   238 MMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHR 302

  Fly   267 GERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQ 331
            |.:|:.|..|.|.|.....|..|...|:..:.::|..|.:.|:.|:.:::|             :
  Fly   303 GIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQH-------------E 354

  Fly   332 ETK 334
            |||
  Fly   355 ETK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 23/87 (26%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 10/24 (42%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 6/23 (26%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 24/99 (24%)
C2H2 Zn finger 225..245 CDD:275368 2/19 (11%)
COG5048 <250..369 CDD:227381 40/121 (33%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 13/21 (62%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 294..318 CDD:290200 10/23 (43%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
C2H2 Zn finger 337..353 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.