DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CTCF

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster


Alignment Length:342 Identity:82/342 - (23%)
Similarity:122/342 - (35%) Gaps:124/342 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EPYASSNRVQE--QEPVLATMLRECSGCSVHKEDGMPQFICVECAEAVRNAYRLRRQCRKSHQYF 85
            ||......::|  .||.:::|:.|.|..:|.:       ..||.|.|.                 
  Fly   199 EPMDLERELEELVDEPDISSMVTELSDYTVDE-------AAVEAATAT----------------- 239

  Fly    86 EQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELV----QVKYMPPEPKPI 146
                |...|.:..|:    .||           |....|.::...|:.|    :||.     |..
  Fly   240 ----LTPNEAEVYEF----EDN-----------ATTEDENADKKDVDFVLSNKEVKL-----KTA 280

  Fly   147 SSPLPDNNE--HKLAQSYSPAKTPHNKSK-----RRARSYSDNDSWSPDSELEHEDDDKIWNASK 204
            ||...::|.  ||    ||....|:..||     |.:||:.                        
  Fly   281 SSTSQNSNASGHK----YSCPHCPYTASKKFLITRHSRSHD------------------------ 317

  Fly   205 RGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTR------ 263
                  |...::|.:|.:||.....|:.|:..|.|.:|:||.||..:|...|.|..|||      
  Fly   318 ------VEPSFKCSICERSFRSNVGLQNHINTHMGNKPHKCKLCESAFTTSGELVRHTRYKHTKE 376

  Fly   264 -----------------------CHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQ 305
                                   |||||||:.||:|....:.:.:|:.|...||||:.::|..|:
  Fly   377 KPHKCTECTYASVELTKLRRHMTCHTGERPYQCPHCTYASQDMFKLKRHMVIHTGEKKYQCDICK 441

  Fly   306 QSFKQLNGLQKHMSAHT 322
            ..|.|.|.|:.|...|:
  Fly   442 SRFTQSNSLKAHKLIHS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 13/66 (20%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 10/24 (42%)
C2H2 Zn finger 245..265 CDD:275368 9/48 (19%)
zf-H2C2_2 257..282 CDD:290200 14/53 (26%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
CTCFNP_648109.1 23ISL <116..206 CDD:293226 2/6 (33%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
COG5048 321..>621 CDD:227381 43/138 (31%)
zf-C2H2 322..344 CDD:278523 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 337..361 CDD:290200 10/23 (43%)
C2H2 Zn finger 352..373 CDD:275368 9/20 (45%)
C2H2 Zn finger 381..401 CDD:275368 0/19 (0%)
zf-H2C2_2 394..415 CDD:290200 10/20 (50%)
C2H2 Zn finger 409..429 CDD:275368 5/19 (26%)
zf-H2C2_2 422..446 CDD:290200 9/23 (39%)
C2H2 Zn finger 437..457 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..485 CDD:275368
C2H2 Zn finger 496..516 CDD:275370
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 536..561 CDD:290200
C2H2 Zn finger 552..573 CDD:275368
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.