DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG10147

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster


Alignment Length:447 Identity:104/447 - (23%)
Similarity:155/447 - (34%) Gaps:136/447 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDG--MPQFICVECAEAVR 69
            ||||  .||...|  .|.|   |.:  ..|.||....||:...|..:|.  :|..||.||.|.:.
  Fly     7 CRVC--SSDVARD--DEAY---NLL--HHPYLAVKFSECTNLVVDPDDQDILPSEICSECYELLE 62

  Fly    70 NAYRLRRQCRKSHQYFEQLRLM-MKELDDIEYCLNIGDNIE------------PQMPV--SVMEA 119
            ..:..|..|..:...:....|: .|::|..:....:.::.|            |:|.:  :.:.|
  Fly    63 KFHSFRALCIIADNKWRSKSLVTWKKIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSA 127

  Fly   120 GKTP---ETSEPLLV-----ELVQVKYMPPEPKPISSPLPDNNEHK---LAQSYSPAK--TPHNK 171
            ..||   |.:.|.||     |.||   .|||.:..:...|....:|   .|..:...|  ..|.|
  Fly   128 QNTPIVAEQAPPTLVFHTFTENVQ---QPPETEKKALEEPPLTTYKCDLCADEFREEKRLILHKK 189

  Fly   172 SKRRARSYSDNDSWSPDS----------ELEHED-------DDKIWNASKR-------------- 205
            ..:....|...:....::          ||||.:       :::..|...|              
  Fly   190 EHQGHMLYHCTEPGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRMYRHKASLKYHQSKAHD 254

  Fly   206 -GKPKRV-----------PG----------------PYRCKL--CTQSFTQKQNLEIHMRIHTGE 240
             |||.:.           .|                ||.|:|  |:..|...:.|:|||..|.|.
  Fly   255 IGKPLKTHMCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRFYSTEKLKIHMMRHQGI 319

  Fly   241 RPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCP---------------------------- 277
            :.:.|..|......|..|:.|...||.||.:.|.:||                            
  Fly   320 KNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHEKARDYACSYC 384

  Fly   278 -KRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQET 333
             |:|......:.|..|||||:.|:|..|.:.|.|.:.|:.|...|..|    .:|:|
  Fly   385 EKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVHESG----DNQQT 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 25/82 (30%)
zf-C2H2 215..237 CDD:278523 9/23 (39%)
C2H2 Zn finger 217..237 CDD:275368 8/21 (38%)
zf-H2C2_2 229..254 CDD:290200 8/24 (33%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 11/53 (21%)
C2H2 Zn finger 273..293 CDD:275368 6/48 (13%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 25/81 (31%)
C2H2 Zn finger 171..191 CDD:275368 4/19 (21%)
zf-C2H2_8 199..287 CDD:292531 10/87 (11%)
C2H2 Zn finger 199..221 CDD:275368 2/21 (10%)
C2H2 Zn finger 230..253 CDD:275368 2/22 (9%)
C2H2 Zn finger 264..284 CDD:275368 1/19 (5%)
C2H2 Zn finger 294..316 CDD:275368 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 3/20 (15%)
C2H2 Zn finger 381..401 CDD:275368 3/19 (16%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.