DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG10321

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:370 Identity:84/370 - (22%)
Similarity:134/370 - (36%) Gaps:100/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAE 66
            :|.|.|....:|.|        |:.|.:...:.|..:           :...||       |.:.
  Fly   449 EIDQDCEYIGEEQD--------PHLSGDVDDDLEYSI-----------MEPPDG-------ETSV 487

  Fly    67 AVRNAYRLRRQCRKSH--QYFEQLRLMMKELDDIEYCLNIGDN---IEPQMPVSVMEAGKTPETS 126
            .:..|:   ....:||  |:.|:::.:..|...:|:.......   :.|.|.||  .|..||:.:
  Fly   488 DIDQAF---MDSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVS--SASPTPKRA 547

  Fly   127 E------PLLVELVQVKYMPPEP-KPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDS 184
            :      |..|.|....:.||.. ...||.|...|..:|.|:.|..          |.:.:| |:
  Fly   548 KRSNHQIPAGVTLEPCDHQPPAAGSTTSSKLAAANSRQLVQTASVI----------AAAGAD-DN 601

  Fly   185 WSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTG------ERPY 243
            :..|:.|..|...:  :.|..|.     |.|.|.||:..|.|.:.|:.||..||.      ::..
  Fly   602 YEIDANLVTEFIRQ--HTSPLGS-----GRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQP 659

  Fly   244 KCSLCPRSFAQKGNLQSHTRCHTGE----------RPF--------------------GCPNCPK 278
            :|.:|.:||...|.|:.|.:.|..|          |.|                    |..||.|
  Fly   660 QCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQQRAYCCGVANCRK 724

  Fly   279 RFRQVGQLQVHT-RTH--TGEQPFKCSKCQQSFKQLNGLQKHMSA 320
            .|.....|:.|. |.|  ..:..|||.:|...:..::.||.|:.:
  Fly   725 NFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHVES 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 14/83 (17%)
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 9/30 (30%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/54 (20%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 286..310 CDD:290200 8/26 (31%)
C2H2 Zn finger 301..321 CDD:275368 5/20 (25%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 17/95 (18%)
C2H2 Zn finger 627..647 CDD:275368 8/19 (42%)
C2H2 Zn finger 661..681 CDD:275368 7/19 (37%)
C2H2 Zn finger 690..710 CDD:275368 2/19 (11%)
C2H2 Zn finger 717..740 CDD:275368 8/22 (36%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.