DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG10631

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster


Alignment Length:279 Identity:66/279 - (23%)
Similarity:103/279 - (36%) Gaps:37/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPL 129
            |..|..|:....|.::..|..:|.:...::....::.........|.|..::|........|||:
  Fly   132 ANTVAYAHNQLLQYQQQQQQQQQQQQQQQQQHQHQHLPQHISQQRPYMGHNIMTGSYPYIKSEPM 196

  Fly   130 LVELVQVKYMPPEPKP----ISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSD--NDSWSPD 188
            .........|.|.|.|    .|.|:   :||....:|....||.....:    :|:  .|..||.
  Fly   197 EAYQQPPNPMAPPPAPEVLIKSEPI---DEHSYKSNYIDDNTPFADFSK----FSEFSEDMLSPK 254

  Fly   189 SELEHEDDD---------KIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGER--- 241
            .||..:|:.         :....|.||. :.:|   .|:.|.:.|.:||   :::| |..|.   
  Fly   255 VELTVKDESYGRTTSSFLRRKQQSDRGN-ESLP---ICQRCKEVFFKKQ---VYLR-HVAESNCG 311

  Fly   242 ----PYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCS 302
                .:|||.||.||.....||.|...|..:|.|....|.|.|..:.:.:.|.........|.|:
  Fly   312 IQEYDFKCSTCPMSFMTTEELQRHKLHHRADRFFCHKYCGKHFDTIAECEAHEYMQHEYDSFVCN 376

  Fly   303 KCQQSFKQLNGLQKHMSAH 321
            .|..:|.....|..|:..|
  Fly   377 MCSGTFATREQLYAHLPQH 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 5/22 (23%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 10/31 (32%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 4/19 (21%)
zf-H2C2_2 286..310 CDD:290200 5/23 (22%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 8/26 (31%)
C2H2 Zn finger 319..339 CDD:275368 9/19 (47%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.