DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG15269

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster


Alignment Length:318 Identity:80/318 - (25%)
Similarity:125/318 - (39%) Gaps:99/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAE 66
            :||..||:|.....|           |..:|..|             ..||.   |::.|.:|.:
  Fly   295 EISYKCRICEKVFGC-----------SETLQAHE-------------KTHKS---PRYECADCGK 332

  Fly    67 AVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLV 131
            .                 |.|||       :.:|.|::....: :......|.|||..       
  Fly   333 G-----------------FSQLR-------NYKYHLSVHRGTK-EFAAECPECGKTFN------- 365

  Fly   132 ELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDD 196
                      :...:||.|   ..|:..:.|.....|.:.::|.|.:.             |.  
  Fly   366 ----------DKGYLSSHL---KIHRNRKEYECPYCPKSFNQRVAFNM-------------HV-- 402

  Fly   197 DKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSH 261
             :|....|         |::|..|.:.|::|..|:.|||.|:||:||:||:|.:|||.:.|:..|
  Fly   403 -RIHTGVK---------PHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLH 457

  Fly   262 TRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKC--SKCQQSFKQLNGLQKH 317
            .|.|:|.:||.||.|||.|.:...|:.|...|||.:|:.|  ..|.|:|.|.:.::.|
  Fly   458 HRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTH 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 13/81 (16%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 10/25 (40%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/43 (16%)
COG5048 <316..502 CDD:227381 67/271 (25%)
C2H2 Zn finger 327..347 CDD:275368 8/43 (19%)
zf-C2H2 356..377 CDD:278523 7/40 (18%)
C2H2 Zn finger 357..377 CDD:275368 7/39 (18%)
zf-H2C2_2 369..394 CDD:290200 6/27 (22%)
C2H2 Zn finger 385..405 CDD:275368 4/35 (11%)
zf-H2C2_2 397..422 CDD:290200 8/49 (16%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 9/21 (43%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.