| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070249.1 | Gene: | ZNF391 / 346157 | HGNCID: | 18779 | Length: | 358 | Species: | Homo sapiens |
| Alignment Length: | 281 | Identity: | 79/281 - (28%) |
|---|---|---|---|
| Similarity: | 134/281 - (47%) | Gaps: | 48/281 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 EAVRNAYRLRRQCR---KSHQYFE-----QLRLMMKEL-------DDIEYCLNIGDNIEPQMPV- 114
Fly 115 ----SVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRR 175
Fly 176 ARSYSDN---DSWSPDSEL-EHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRI 236
Fly 237 HTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKC 301
Fly 302 SKCQQSFKQLNGLQKHMSAHT 322 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 7/29 (24%) |
| zf-C2H2 | 215..237 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
| ZNF391 | NP_001070249.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | 5/21 (24%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 56..94 | 5/39 (13%) | |||
| C2H2 Zn finger | 111..131 | CDD:275368 | 6/24 (25%) | ||
| zf-H2C2_2 | 123..148 | CDD:290200 | 3/24 (13%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 6/26 (23%) | ||
| zf-H2C2_2 | 151..176 | CDD:290200 | 9/36 (25%) | ||
| COG5048 | <163..340 | CDD:227381 | 48/115 (42%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 179..204 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 195..215 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 207..230 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 223..243 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 238..259 | CDD:290200 | 11/20 (55%) | ||
| C2H2 Zn finger | 251..271 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 263..288 | CDD:290200 | 4/10 (40%) | ||
| C2H2 Zn finger | 279..299 | CDD:275368 | |||
| zf-H2C2_2 | 291..316 | CDD:290200 | |||
| C2H2 Zn finger | 307..327 | CDD:275368 | |||
| zf-H2C2_2 | 319..342 | CDD:290200 | |||
| zf-C2H2 | 333..355 | CDD:278523 | |||
| C2H2 Zn finger | 335..355 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||