| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001004309.2 | Gene: | ZNF774 / 342132 | HGNCID: | 33108 | Length: | 483 | Species: | Homo sapiens |
| Alignment Length: | 350 | Identity: | 92/350 - (26%) |
|---|---|---|---|
| Similarity: | 133/350 - (38%) | Gaps: | 94/350 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 CSGCS------------VHKEDGMPQFICVECAEAVRNAYRL---RR--------QCRKSHQYFE 86
Fly 87 QLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPLP 151
Fly 152 DNNEHKLAQSYSPAKT--PHNKSKRRARSYSDND---SWSPDSEL-EHE---DDDKIWNASKRGK 207
Fly 208 -------------------PKRVPG----------------------PYRCKLCTQSFTQKQNLE 231
Fly 232 IHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGE 296
Fly 297 QPFKCSKCQQSFKQLNGLQKHMSAH 321 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 12/65 (18%) |
| zf-C2H2 | 215..237 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 15/23 (65%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 9/19 (47%) | ||
| ZNF774 | NP_001004309.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..101 | ||
| COG5048 | 152..483 | CDD:227381 | 91/349 (26%) | ||
| C2H2 Zn finger | 153..173 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 165..190 | CDD:290200 | 4/24 (17%) | ||
| C2H2 Zn finger | 181..201 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 193..217 | CDD:290200 | 5/23 (22%) | ||
| C2H2 Zn finger | 209..229 | CDD:275368 | 3/24 (13%) | ||
| zf-H2C2_2 | 222..246 | CDD:290200 | 7/34 (21%) | ||
| C2H2 Zn finger | 237..257 | CDD:275368 | 7/27 (26%) | ||
| zf-H2C2_2 | 249..274 | CDD:290200 | 6/34 (18%) | ||
| C2H2 Zn finger | 265..285 | CDD:275368 | 5/22 (23%) | ||
| zf-H2C2_2 | 277..302 | CDD:290200 | 5/24 (21%) | ||
| zf-C2H2 | 291..313 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 305..328 | CDD:290200 | 4/22 (18%) | ||
| C2H2 Zn finger | 321..341 | CDD:275368 | 2/19 (11%) | ||
| zf-C2H2 | 347..369 | CDD:278523 | 1/21 (5%) | ||
| C2H2 Zn finger | 349..369 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 361..385 | CDD:290200 | 3/23 (13%) | ||
| C2H2 Zn finger | 377..397 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 389..414 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 405..425 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 417..442 | CDD:290200 | 11/24 (46%) | ||
| zf-C2H2 | 431..453 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 433..453 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 445..470 | CDD:290200 | 15/24 (63%) | ||
| C2H2 Zn finger | 461..481 | CDD:275368 | 9/19 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||