DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG31441

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:369 Identity:85/369 - (23%)
Similarity:147/369 - (39%) Gaps:78/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAE 66
            ::..:||.|......|....|:.:..||.      ...::|...:...:..:..:|..||..|..
  Fly     3 ELRSICRTCGKNVTNLQGRATKLFNKSNY------HFISILENITDMYLEFDTTLPHLICQCCKV 61

  Fly    67 AVRNAYRLRRQCRKSHQYF-----EQLR---LMMKELD--DIEYC-LNIGDNIEPQMPVSVME-A 119
            .:......|.:|.:.|:.|     :.||   ::.:|||  |:|.. .::.|:.:.:|.|::.: |
  Fly    62 QLDRILTFRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMADTA 126

  Fly   120 GKTPETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDS 184
            |        ||.|                   |:|:::.|:....|.......:.:.:..::   
  Fly   127 G--------LLRE-------------------DHNDNEKAKDAEDATQNEKNQEEQVQVQTE--- 161

  Fly   185 WSPDSELEHEDDDKIWNAS--KRGKPKRVP-------GPYRCKLCTQSFTQKQNLEIHMRIHTGE 240
                 |:|| ..:::.|.|  .:|...|||       ..:.|..|...|.....|::|::.|:|.
  Fly   162 -----EVEH-CQEQLHNMSIISKGVSARVPKRTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGH 220

  Fly   241 RPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQ 305
            :|:.|.:|...:.....::.|...||..||:.|..|.|.:|......||.||||.|:||:|..|.
  Fly   221 KPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCD 285

  Fly   306 QSFKQLNGLQKHMSAHT---------------RGKRRTSSQETK 334
            ::|...:..|||...||               |....|..|.||
  Fly   286 KAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLHQSTK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/86 (19%)
zf-C2H2 215..237 CDD:278523 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
zf-H2C2_2 229..254 CDD:290200 7/24 (29%)
C2H2 Zn finger 245..265 CDD:275368 3/19 (16%)
zf-H2C2_2 257..282 CDD:290200 8/24 (33%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 16/80 (20%)
COG5048 <174..337 CDD:227381 46/156 (29%)
C2H2 Zn finger 197..217 CDD:275370 5/19 (26%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.