Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314845.1 | Gene: | wu:fc30c06 / 324469 | ZFINID: | ZDB-GENE-030131-3190 | Length: | 424 | Species: | Danio rerio |
Alignment Length: | 257 | Identity: | 75/257 - (29%) |
---|---|---|---|
Similarity: | 103/257 - (40%) | Gaps: | 69/257 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 SVMEAGKTPETSEPL------------LVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKT 167
Fly 168 PHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEI 232
Fly 233 HMRIHTGERPYKCSLCPRSFAQK----------------------------GNLQSHTRCHTGER 269
Fly 270 PFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQ 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 10/47 (21%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 5/19 (26%) | ||
wu:fc30c06 | NP_001314845.1 | C2H2 Zn finger | 94..114 | CDD:275368 | 12/19 (63%) |
zf-H2C2_2 | 106..131 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 122..142 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 146..>390 | CDD:227381 | 31/91 (34%) | ||
C2H2 Zn finger | 150..170 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 178..198 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 191..215 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 234..254 | CDD:275368 | 1/3 (33%) | ||
zf-H2C2_2 | 246..271 | CDD:290200 | |||
C2H2 Zn finger | 262..282 | CDD:275368 | |||
C2H2 Zn finger | 290..310 | CDD:275368 | |||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
C2H2 Zn finger | 346..366 | CDD:275368 | |||
zf-H2C2_2 | 359..381 | CDD:290200 | |||
C2H2 Zn finger | 374..394 | CDD:275368 | |||
C2H2 Zn finger | 402..422 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588259 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |