DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG4318

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster


Alignment Length:299 Identity:85/299 - (28%)
Similarity:125/299 - (41%) Gaps:71/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISQMCRVCRDESDCLLDIY-TEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVEC 64
            || |:|||||..|.:.:|.|: |.|....:        ||||:.:..|..|..:|..|:.||..|
  Fly     1 MD-SRMCRVCLREMENMLCIFETMPLPGVS--------LATMISDWCGFPVLPKDPFPKTICQSC 56

  Fly    65 AEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGD--NIEPQMPVSVMEAGKTPETSE 127
            |...:.||.:     .|.|..||..:::.|::..|...|..|  .|||      ::..:..||  
  Fly    57 ALDAQTAYGM-----DSVQVIEQDEMVVSEMNYEEEGSNDSDVELIEP------VDGSQEMET-- 108

  Fly   128 PLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELE 192
               ::|.           |.|| .||.|:....|.|                :.|.:.|..|   
  Fly   109 ---IDLT-----------IDSP-GDNVENMCPNSNS----------------NGNGNVSQSS--- 139

  Fly   193 HEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGN 257
                     |.|..|.|.:...::|.:|.:.|....:|:.||.:|..|:||||..|.:|:||...
  Fly   140 ---------AQKDTKKKMLKKTHKCNICGKYFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRG 195

  Fly   258 LQSHTRCHTGE---RPFGCPNCPKRFRQVGQLQVHTRTH 293
            |:.|.|.|:..   |.:.|..|||.|.:...|:.|...|
  Fly   196 LRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMH 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 27/82 (33%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 10/27 (37%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 3/8 (38%)
C2H2 Zn finger 301..321 CDD:275368
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 22/66 (33%)
C2H2 Zn finger 155..175 CDD:275368 6/19 (32%)
zf-H2C2_2 167..192 CDD:290200 11/24 (46%)
COG5048 <179..>236 CDD:227381 21/56 (38%)
C2H2 Zn finger 183..203 CDD:275368 8/19 (42%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.