DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG11695

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:398 Identity:78/398 - (19%)
Similarity:148/398 - (37%) Gaps:88/398 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAEAVRN 70
            :||:|.|:::..:.|:.:..:....|...   ||.::.:.....:...||:.:.:|.:|.:.:.:
  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQPVPSN---LAELIEKHLQLVLLPNDGVSKSLCTQCWQQLAD 63

  Fly    71 AYRLRRQCRKSHQYFEQLRL-MMKELDDIEYCLNIGDNIEPQMPVSVMEA---------GKTPET 125
            ..:......|.....:||:: ...|.:|.:....|  ..||::.||...|         |.....
  Fly    64 FEQFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQI--LCEPEIDVSPAAADNEECNEIDGDASSN 126

  Fly   126 SEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSE 190
            |....:....::.|       ..|.|.....:|.::.:..||...|:|.|.:::........|:|
  Fly   127 SRSSSIRTTSLREM-------RLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAE 184

  Fly   191 LEHEDDDKIWNA-----------------------------------------------SKRGKP 208
            .|.:.:.:..|:                                               .:|.|.
  Fly   185 GEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKK 249

  Fly   209 KRV----------PGPYRCKLCTQSFTQKQNLEIHM-RIHTG--ERPYKCSLCPRSFAQKGNLQS 260
            :.:          |..:|||:|::....:.:.::|| |.|..  :..:.|..|.:.|:::..|..
  Fly   250 RALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTI 314

  Fly   261 HTRCHTGERPFGCPNCPKRFRQVGQLQVH-TRTH-TGEQPFKCSKCQQSFKQLNGLQKHMSAHTR 323
            |:|.|..||...|.:|.:.||....|::| .||| ....||.|..|...||    .::::..|.|
  Fly   315 HSRVHQQERNEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFK----TKQNLLVHKR 375

  Fly   324 GKRRTSSQ 331
            ...|..||
  Fly   376 TVHREGSQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 13/81 (16%)
zf-C2H2 215..237 CDD:278523 7/22 (32%)
C2H2 Zn finger 217..237 CDD:275368 6/20 (30%)
zf-H2C2_2 229..254 CDD:290200 7/27 (26%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 286..310 CDD:290200 10/25 (40%)
C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 13/81 (16%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..348 CDD:275368 7/20 (35%)
C2H2 Zn finger 357..376 CDD:275368 5/22 (23%)
C2H2 Zn finger 389..409 CDD:275368
C2H2 Zn finger 420..440 CDD:275368
C2H2 Zn finger 448..468 CDD:275368
C2H2 Zn finger 476..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.