DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG11696

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:483 Identity:92/483 - (19%)
Similarity:155/483 - (32%) Gaps:177/483 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVEC----AE 66
            :||:|.::::..:.|:.:..........|   ||.::.......:.:.|.:...:|..|    ||
  Fly     2 ICRLCLEDAEHGVPIFGQEPPMGQPAHRQ---LAELIERHLLLVLAENDVVSTCLCNRCWRQLAE 63

  Fly    67 AVRNAYRLRRQCRKSHQYFEQLRLMMKELDDI---EYCL---NIGDNIEPQMP------------ 113
            ..:....:..:.|..|:.. ||:..:.||.::   |..|   |....|||::.            
  Fly    64 IEQFCSMVAEKQRSLHRSL-QLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHILC 127

  Fly   114 ---VSVMEAGKTP-----ETSEPLLVELVQVKYMP---------PEPKPISSPLPDNNEHK--LA 159
               :..:.||...     :|.||        .:.|         |||.|: .|.|.....|  |.
  Fly   128 EPVIDALSAGDEKDSDYGDTFEP--------DFEPESQPDEEEEPEPDPV-KPRPRGRPRKTALQ 183

  Fly   160 QSYSPAKTPHNKSK----------------------RRARSYSDNDSWSPDSELEHED------- 195
            |::...|..:.|.|                      :|:.:.:::|....:.|.:.||       
  Fly   184 QTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDEDEEDEEDVGGELTP 248

  Fly   196 --DDKIWNASKRGKPK------------------------------------------------- 209
              |::.....|||:||                                                 
  Fly   249 DADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLEDFN 313

  Fly   210 ------RV------------------------------PGPYRCKLCTQSFTQKQNLEIHM-RIH 237
                  ||                              |..:.|:.|.::|..:.:..:|| |.|
  Fly   314 DLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFH 378

  Fly   238 TGERP--YKCSLCPRSFAQKGNLQSHTRCHTG-ERPFGCPNCPKRFRQVGQLQVHT-RTHTGE-Q 297
            :.::.  ::|::|...||:|..|..|.:.|.| |||..|..|.|.||...:|..|. |.|..: .
  Fly   379 SQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEVCDTCSKTFRTKFELSAHVKRMHAADFT 443

  Fly   298 PFKCSKCQQSFKQLNGLQKHMSA-HTRG 324
            |..|..|...|:.......|..| |..|
  Fly   444 PIICDICGTHFRSKANFLIHKKALHPDG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 14/85 (16%)
zf-C2H2 215..237 CDD:278523 6/22 (27%)
C2H2 Zn finger 217..237 CDD:275368 6/20 (30%)
zf-H2C2_2 229..254 CDD:290200 7/27 (26%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/25 (44%)
C2H2 Zn finger 273..293 CDD:275368 8/20 (40%)
zf-H2C2_2 286..310 CDD:290200 8/25 (32%)
C2H2 Zn finger 301..321 CDD:275368 5/20 (25%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 13/78 (17%)
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.