DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and Zfp672

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001243445.1 Gene:Zfp672 / 319475 MGIID:2442105 Length:468 Species:Mus musculus


Alignment Length:372 Identity:97/372 - (26%)
Similarity:136/372 - (36%) Gaps:103/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PVLATMLRECSGCSV-------------HK--EDGMPQFICVECAEAVRNAYRLRRQ-------- 77
            |.:||.......|||             |:  ..|..:|.|:||.|....|..||..        
Mouse     5 PGMATTQERPYSCSVCGKSFQYSAVLLRHERAHGGDKRFCCLECGERCARAADLRAHRWTHAGQT 69

  Fly    78 ---CRKSHQYFEQLRLMMKELDDIEYCLNIGDNIE--------------PQMPVSVMEAGKTPET 125
               |.:..|.|....|    ||     |::|.:..              |.:|..::...:....
Mouse    70 LYICSECGQSFSHSGL----LD-----LHLGTHRRRSRTRPCRLCGRRFPHVPALLLHRARQHPP 125

  Fly   126 SEPLLVELVQVKYM------------PPEPKPISSPLPDNNEH--KLAQSYSPAKTPHNKSK-RR 175
            .:|....|....:.            |||...:::|.|....|  :..:::..:....|.|: ..
Mouse   126 EKPHRCPLCARSFRQSALPFHLARAHPPEIITVTAPSPSTLYHCTQCPRAFHSSAGLRNHSRIHV 190

  Fly   176 ARSYSD-----------NDSWSPDS----ELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFT 225
            ..|.||           ..|:|..|    .|:....:|               |::|..|.:.|.
Mouse   191 VPSLSDPGTEAHLCGICGKSFSKSSTLTRHLQRHSGEK---------------PFKCPECGKGFL 240

  Fly   226 QKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHT 290
            :...|..|.|.||||:||.||.|.|.|::...|..|.|.|.||||..|..|.|.|.|...|.||.
Mouse   241 ESATLVRHQRTHTGEKPYACSDCGRCFSESSTLLRHQRSHQGERPHVCATCGKGFGQRYDLVVHQ 305

  Fly   291 RTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR---------GKRRT 328
            |:||||:||.|.:|.:.|...:.|.||:..||.         |||.|
Mouse   306 RSHTGERPFPCPQCGRGFTDRSDLTKHLRTHTGEKPYHCELCGKRFT 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 19/77 (25%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
Zfp672NP_001243445.1 C2H2 Zn finger 17..37 CDD:275368 4/19 (21%)
C2H2 Zn finger 45..65 CDD:275368 7/19 (37%)
C2H2 Zn finger 73..93 CDD:275368 8/28 (29%)
C2H2 Zn finger 105..123 CDD:275370 2/17 (12%)
COG5048 <121..349 CDD:227381 67/242 (28%)
C2H2 Zn finger 169..189 CDD:275368 2/19 (11%)
C2H2 Zn finger 204..224 CDD:275368 4/19 (21%)
C2H2 Zn finger 232..252 CDD:275368 6/19 (32%)
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
C2H2 Zn finger 288..308 CDD:275368 9/19 (47%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
C2H2 Zn finger 344..364 CDD:275368 4/9 (44%)
zf-H2C2_2 356..380 CDD:404364
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.