DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and CG10959

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:405 Identity:88/405 - (21%)
Similarity:138/405 - (34%) Gaps:116/405 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVEC----------AEAVRN 70
            ||.::   .|...:..|:..|       :|.......|....|.:|:.|          |..:||
  Fly     5 CLANV---DYVRLHAQQQLRP-------KCGEIFYEPEANRFQLVCLLCDMKHFGFEDFARHIRN 59

  Fly    71 AY-------------RLRRQCRKSHQY------------FEQLRL----MMKELDDIEYCLNIGD 106
            .:             .|.|..|:..::            |::..|    ::.|.:|.|.  .:|.
  Fly    60 VHFDKQGRPLTKTVTGLGRLAREEQEFQGVSAEPLAVDSFKKEYLPNEDVLSEEEDAEQ--ELGL 122

  Fly   107 NIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISS--------------------PLP 151
            ..:...|:.:|..|......|    |.:...:.|......:|                    |..
  Fly   123 EQDEGNPLRIMVLGGKQSVDE----ETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDE 183

  Fly   152 DNNEH----KLAQSYSPAKTPHNKSKRRARSYSDND------------------SWSPDSEL--- 191
            |..||    |..:.......||...:...:.|.:..                  ::..|..|   
  Fly   184 DGEEHQSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQH 248

  Fly   192 ---EHED-----DDKIWNASKRGKPKRVPG-----PYRC--KLCTQSFTQKQNLEIHMRIHTGER 241
               ||.:     .||::.:| |...:.|.|     .::|  :.|.:||..:.||..|.|:|:.||
  Fly   249 RRKEHTEFACQLCDKVFKSS-RSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEER 312

  Fly   242 PYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQ 306
            .|.|.||......:..|..|.|.||||:||.|..|.:||.....|..|...|:.|:|:||.||..
  Fly   313 NYVCELCGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDS 377

  Fly   307 SFKQLNGLQKHMSAH 321
            :|.:...|..|...|
  Fly   378 AFSRPKALYHHKHLH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 17/106 (16%)
zf-C2H2 215..237 CDD:278523 8/23 (35%)
C2H2 Zn finger 217..237 CDD:275368 8/21 (38%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 2/20 (10%)
COG5048 <258..416 CDD:227381 47/136 (35%)
C2H2 Zn finger 258..278 CDD:275368 5/20 (25%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 13/24 (54%)
C2H2 Zn finger 344..364 CDD:275368 6/19 (32%)
zf-H2C2_2 357..381 CDD:290200 10/23 (43%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.