DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and Zfp672

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001007670.1 Gene:Zfp672 / 303165 RGDID:1359094 Length:468 Species:Rattus norvegicus


Alignment Length:389 Identity:105/389 - (26%)
Similarity:144/389 - (37%) Gaps:117/389 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IYTEPYASSNRVQEQEPVLATMLRECSGCSV----------HK--EDGMPQFICVECAEAVRNAY 72
            ::|.|..::.|   :.|.      .||.|..          |:  ..|..:|.|:||.|....|.
  Rat     1 MFTAPGVAATR---ERPY------SCSVCGKSFQYSAVLLRHERAHGGDKRFRCLECGERCARAS 56

  Fly    73 RLRRQ-----------CRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKT-PET 125
            .||..           |.:..|.|....|    ||     |::|.:............|:. |..
  Rat    57 DLRVHRWTHAGQTLYICSECGQSFSHSSL----LD-----LHLGTHRRRSSTCPCRLCGRRFPHV 112

  Fly   126 SEPLLVELVQVKYMPPEPKPISSPLPDNNEHK------LAQSYSPAKT----------------P 168
            |..|   |.:|:..||| ||...||...:..:      ||:::.|..|                |
  Rat   113 SALL---LHRVRQHPPE-KPHRCPLCARSFRQSALPFHLARAHPPETTIATAPAPSTLYHCTQCP 173

  Fly   169 ---HNKSKRR-------ARSYSD-----------NDSWSPDS----ELEHEDDDKIWNASKRGKP 208
               |:.:..|       ..|.||           ..|:|..|    .|:....:|          
  Rat   174 RAFHSSAGLRNHSRIHVVPSLSDPGAEAHRCGVCGKSFSKSSTLTRHLQRHSGEK---------- 228

  Fly   209 KRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGC 273
                 |::|..|.:.|.:...|..|.|.||||:||.|:.|.|.|::...|..|.|.|.||||..|
  Rat   229 -----PFKCPECGKGFLESATLVRHQRTHTGEKPYACNDCGRCFSESSTLLRHQRSHQGERPHIC 288

  Fly   274 PNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR---------GKRRT 328
            ..|.|.|.|...|.||.|:||||:||.|.:|.:.|...:.|.||:..||.         |||.|
  Rat   289 ATCGKGFGQRYDLVVHQRSHTGERPFPCPECGRGFTDRSDLTKHLRTHTGEKPYHCELCGKRFT 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 20/90 (22%)
zf-C2H2 215..237 CDD:278523 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
Zfp672NP_001007670.1 COG5048 13..416 CDD:227381 102/374 (27%)
C2H2 Zn finger 17..37 CDD:275368 4/19 (21%)
C2H2 Zn finger 45..65 CDD:275368 7/19 (37%)
C2H2 Zn finger 73..93 CDD:275368 8/28 (29%)
C2H2 Zn finger 102..123 CDD:275368 6/23 (26%)
C2H2 Zn finger 169..189 CDD:275368 3/19 (16%)
C2H2 Zn finger 204..224 CDD:275368 4/19 (21%)
C2H2 Zn finger 232..252 CDD:275368 6/19 (32%)
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
C2H2 Zn finger 288..308 CDD:275368 9/19 (47%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
C2H2 Zn finger 344..364 CDD:275368 4/9 (44%)
C2H2 Zn finger 372..392 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.