DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17359 and Zfp689

DIOPT Version :9

Sequence 1:	NP_648679.1	Gene:	CG17359 / 39549	FlyBaseID:	FBgn0036396	Length:	339	Species:	Drosophila melanogaster
Sequence 2:	NP_775452.1	Gene:	Zfp689 / 286996	RGDID:	628696	Length:	500	Species:	Rattus norvegicus

Alignment Length:	125	Identity:	54/125 - (43%)
Similarity:	71/125 - (56%)	Gaps:	8/125 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            ||.|..|.:.|:|::||..|..|||||:||.|..|.|.|.:..:|.:|...||||:|..||:|.:
  Rat   204 PYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQCPSCGR 268

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGK--------RRTSS 330
            ||.....|.:|.||||||:|:.|.:|.:.|:|...|..|...||..|        ||.||
  Rat   269 RFAYPSLLAIHQRTHTGEKPYTCLECSRRFRQRTALVIHQRIHTGEKPYPCPDCERRFSS 328

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17359	NP_648679.1	zf-AD	6..88	CDD:285071
		zf-C2H2	215..237	CDD:278523	8/21 (38%)
		C2H2 Zn finger	217..237	CDD:275368	7/19 (37%)
		zf-H2C2_2	229..254	CDD:290200	14/24 (58%)
		C2H2 Zn finger	245..265	CDD:275368	6/19 (32%)
		zf-H2C2_2	257..282	CDD:290200	12/24 (50%)
		C2H2 Zn finger	273..293	CDD:275368	8/19 (42%)
		zf-H2C2_2	286..310	CDD:290200	12/23 (52%)
		C2H2 Zn finger	301..321	CDD:275368	6/19 (32%)
Zfp689	NP_775452.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24
		KRAB	29..88	CDD:214630
		KRAB	29..68	CDD:279668
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	110..144
		C2H2 Zn finger	151..171	CDD:275368
		COG5048	159..>466	CDD:227381	54/125 (43%)
		C2H2 Zn finger	179..199	CDD:275368
		C2H2 Zn finger	207..227	CDD:275368	7/19 (37%)
		zf-H2C2_2	219..244	CDD:290200	14/24 (58%)
		C2H2 Zn finger	235..255	CDD:275368	6/19 (32%)
		zf-H2C2_2	247..272	CDD:290200	12/24 (50%)
		C2H2 Zn finger	263..283	CDD:275368	8/19 (42%)
		zf-H2C2_2	276..300	CDD:290200	12/23 (52%)
		C2H2 Zn finger	291..311	CDD:275368	6/19 (32%)
		zf-H2C2_2	303..328	CDD:290200	7/24 (29%)
		C2H2 Zn finger	319..339	CDD:275368	4/10 (40%)
		zf-H2C2_2	332..356	CDD:290200
		C2H2 Zn finger	347..367	CDD:275368
		zf-H2C2_2	360..384	CDD:290200
		C2H2 Zn finger	375..395	CDD:275368
		C2H2 Zn finger	403..423	CDD:275368
		zf-H2C2_2	416..440	CDD:290200
		C2H2 Zn finger	431..451	CDD:275368
		C2H2 Zn finger	459..475	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000