DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and ZIK1

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001010879.2 Gene:ZIK1 / 284307 HGNCID:33104 Length:487 Species:Homo sapiens


Alignment Length:367 Identity:97/367 - (26%)
Similarity:138/367 - (37%) Gaps:100/367 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASSNRVQEQE---PVLATMLRECSGCSVHKED--GMPQFICVECAEAVRNAYRLRRQCRKSHQYF 85
            :|:.:.|..|   |||..:|        |..|  |...::..||..        ..|.:|.|...
Human    94 SSTQKTQSCEMCVPVLKDIL--------HLADLPGQKPYLVGECTN--------HHQHQKHHSAK 142

  Fly    86 EQLRLMMKELDDIEY------CLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPK 144
            :.|:   :::|...|      |:::       .|....|.||    ..|.::.|::....|...|
Human   143 KSLK---RDMDRASYVKCCLFCMSL-------KPFRKWEVGK----DLPAMLRLLRSLVFPGGKK 193

  Fly   145 P-----------------ISSPLPDNNEHKLAQSYSP----------------------AKTPHN 170
            |                 .|......:.||....|.|                      :...|.
Human   194 PGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQ 258

  Fly   171 KSKRRARSYSDNDSWSPDSELEHEDD-------DKIWNASKRGKPKRVPG-------------PY 215
            :.....|.:..|:.....|:..|.:|       ::.:..|:.||..|...             ||
Human   259 RVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPY 323

  Fly   216 RCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRF 280
            .|..|.:||:||..|..|.|:|||||||||..|..||:|...|..|.|.|||.:|:.|..|.|.|
Human   324 ECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQCGKSF 388

  Fly   281 RQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHT 322
            .|...|..|.|.||||:|:||..|.:||.|.:.|.:|...||
Human   389 SQKATLIKHQRVHTGERPYKCGDCGKSFSQSSILIQHRRIHT 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 15/66 (23%)
zf-C2H2 215..237 CDD:278523 10/21 (48%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 15/24 (63%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 13/23 (57%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
ZIK1NP_001010879.2 KRAB 27..>68 CDD:214630
KRAB 27..66 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..94 97/367 (26%)
C2H2 Zn finger 215..233 CDD:275368 4/17 (24%)
C2H2 Zn finger 241..261 CDD:275368 1/19 (5%)
zf-H2C2_2 253..278 CDD:290200 3/24 (13%)
COG5048 <269..449 CDD:227381 62/162 (38%)
C2H2 Zn finger 269..289 CDD:275368 4/19 (21%)
zf-H2C2_2 281..306 CDD:290200 5/24 (21%)
C2H2 Zn finger 297..317 CDD:275368 4/19 (21%)
zf-H2C2_2 309..334 CDD:290200 6/24 (25%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)
zf-H2C2_2 338..362 CDD:290200 15/23 (65%)
C2H2 Zn finger 353..373 CDD:275368 8/19 (42%)
zf-H2C2_2 366..390 CDD:290200 11/23 (48%)
C2H2 Zn finger 381..401 CDD:275368 8/19 (42%)
zf-H2C2_2 394..418 CDD:290200 13/23 (57%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
zf-H2C2_2 422..446 CDD:290200 4/9 (44%)
C2H2 Zn finger 437..457 CDD:275368
C2H2 Zn finger 465..485 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.