Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001010879.2 | Gene: | ZIK1 / 284307 | HGNCID: | 33104 | Length: | 487 | Species: | Homo sapiens |
Alignment Length: | 367 | Identity: | 97/367 - (26%) |
---|---|---|---|
Similarity: | 138/367 - (37%) | Gaps: | 100/367 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 ASSNRVQEQE---PVLATMLRECSGCSVHKED--GMPQFICVECAEAVRNAYRLRRQCRKSHQYF 85
Fly 86 EQLRLMMKELDDIEY------CLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPK 144
Fly 145 P-----------------ISSPLPDNNEHKLAQSYSP----------------------AKTPHN 170
Fly 171 KSKRRARSYSDNDSWSPDSELEHEDD-------DKIWNASKRGKPKRVPG-------------PY 215
Fly 216 RCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRF 280
Fly 281 RQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHT 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 15/66 (23%) |
zf-C2H2 | 215..237 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
ZIK1 | NP_001010879.2 | KRAB | 27..>68 | CDD:214630 | |
KRAB | 27..66 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..94 | 97/367 (26%) | |||
C2H2 Zn finger | 215..233 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 241..261 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 253..278 | CDD:290200 | 3/24 (13%) | ||
COG5048 | <269..449 | CDD:227381 | 62/162 (38%) | ||
C2H2 Zn finger | 269..289 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 281..306 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 297..317 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 309..334 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 338..362 | CDD:290200 | 15/23 (65%) | ||
C2H2 Zn finger | 353..373 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 366..390 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 381..401 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 394..418 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 409..429 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 422..446 | CDD:290200 | 4/9 (44%) | ||
C2H2 Zn finger | 437..457 | CDD:275368 | |||
C2H2 Zn finger | 465..485 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |