DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and Zfp954

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_766326.2 Gene:Zfp954 / 232853 MGIID:1917764 Length:416 Species:Mus musculus


Alignment Length:112 Identity:53/112 - (47%)
Similarity:71/112 - (63%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            |::|..|.:||:||..|..|.|:||||:||:||.|.::|....:|.||...||||.||.|..|.|
Mouse   225 PFQCTECGKSFSQKAFLIKHFRMHTGEKPYRCSECGKAFKHNISLISHQGLHTGEMPFKCTECGK 289

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGK 325
            .:|....|:||.|.||||.||:||:|.:|::...||..|..:||..|
Mouse   290 SYRSKEGLKVHYRFHTGEMPFECSECGKSYRSREGLLNHFYSHTAEK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
Zfp954NP_766326.2 KRAB 42..95 CDD:214630
KRAB 42..81 CDD:279668
zf-C2H2 198..220 CDD:278523
C2H2 Zn finger 200..220 CDD:275368
zf-H2C2_2 212..237 CDD:290200 5/11 (45%)
C2H2 Zn finger 228..248 CDD:275368 9/19 (47%)
zf-H2C2_2 241..265 CDD:290200 13/23 (57%)
COG5048 <252..387 CDD:227381 39/85 (46%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
C2H2 Zn finger 284..304 CDD:275368 8/19 (42%)
zf-H2C2_2 297..321 CDD:290200 14/23 (61%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368
zf-C2H2 364..386 CDD:278523
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 394..414 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.