DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and ZNF25

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001316576.1 Gene:ZNF25 / 219749 HGNCID:13043 Length:460 Species:Homo sapiens


Alignment Length:112 Identity:55/112 - (49%)
Similarity:76/112 - (67%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            ||.||.|.::|:||.:|.:|.|:||||:||||..|.:.|::..:|::|.|.||||:|:.|..|.|
Human   261 PYECKECGKAFSQKSHLTVHQRMHTGEKPYKCKECGKFFSRNSHLKTHQRSHTGEKPYECKECRK 325

  Fly   279 RFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGK 325
            .|.|...|.||.||||||:||:|:||.::|...:.|.||...||..|
Human   326 CFYQKSALTVHQRTHTGEKPFECNKCGKTFYYKSDLTKHQRKHTGEK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 10/21 (48%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 15/23 (65%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
ZNF25NP_001316576.1 KRAB 12..72 CDD:214630
KRAB 12..51 CDD:279668
C2H2 Zn finger 124..144 CDD:275368
COG5048 148..457 CDD:227381 55/112 (49%)
C2H2 Zn finger 152..172 CDD:275368
C2H2 Zn finger 180..200 CDD:275368
zf-H2C2_2 192..215 CDD:290200
C2H2 Zn finger 208..228 CDD:275368
zf-H2C2_2 220..243 CDD:290200
C2H2 Zn finger 236..256 CDD:275368
zf-H2C2_2 248..273 CDD:290200 6/11 (55%)
C2H2 Zn finger 264..284 CDD:275368 9/19 (47%)
zf-H2C2_2 276..301 CDD:290200 13/24 (54%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..327 CDD:290200 11/22 (50%)
C2H2 Zn finger 320..340 CDD:275368 9/19 (47%)
zf-H2C2_2 332..357 CDD:290200 15/24 (63%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 360..384 CDD:290200 6/13 (46%)
C2H2 Zn finger 376..396 CDD:275368
zf-H2C2_2 389..413 CDD:290200
C2H2 Zn finger 404..424 CDD:275368
C2H2 Zn finger 432..452 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.