DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and M03D4.4

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:281 Identity:76/281 - (27%)
Similarity:118/281 - (41%) Gaps:75/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTP 123
            ::|.:|:.|..:...|:|..|:.|:..||                 ||..|.:|          .
 Worm     5 YLCRDCSGAFHSLDELQRHEREEHETVEQ-----------------GDQEEDRM----------E 42

  Fly   124 ETSEPLLVELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPD 188
            :.|:    ||..:|....:    |..|.|.:..:|  |.:|. ||..||                
 Worm    43 DDSD----ELAMIKIKIED----SDFLSDTDSSQL--SMNPT-TPSEKS---------------- 80

  Fly   189 SELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFA 253
                        ::.::|:       |.|:.|.:.|..|:.|..|||||:||:|:.|:.|.:.|.
 Worm    81 ------------SSGEKGR-------YECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFG 126

  Fly   254 QKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHM 318
            .:..|:.|...|||||...||:|.|.|.|.|.|..|...|:|.:|.:|.:|.::|.....|.:||
 Worm   127 TRQLLKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHM 191

  Fly   319 SAHTRGKRRTSSQETKRNKFK 339
            ..|.  :|..|.|:..|:..|
 Worm   192 KIHQ--ERGFSCQQCGRSFLK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 8/28 (29%)
zf-C2H2 215..237 CDD:278523 9/21 (43%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 12/24 (50%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 9/19 (47%)
zf-H2C2_2 286..310 CDD:290200 8/23 (35%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 8/19 (42%)
zf-H2C2_2 102..127 CDD:290200 12/24 (50%)
C2H2 Zn finger 118..138 CDD:275368 5/19 (26%)
C2H2 Zn finger 146..166 CDD:275368 9/19 (47%)
zf-H2C2_2 158..181 CDD:290200 7/22 (32%)
zf-C2H2 172..194 CDD:278523 6/21 (29%)
C2H2 Zn finger 174..194 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.