| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021331300.1 | Gene: | LOC110439525 / 110439525 | -ID: | - | Length: | 434 | Species: | Danio rerio |
| Alignment Length: | 207 | Identity: | 74/207 - (35%) |
|---|---|---|---|
| Similarity: | 96/207 - (46%) | Gaps: | 33/207 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 142 EPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRAR---------SYSDNDSWSPDSELEHEDDD 197
Fly 198 KIWNASKRGKP-KRVPG------------PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCP 249
Fly 250 RSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGL 314
Fly 315 QKHMSAHTRGKR 326 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 13/21 (62%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 13/19 (68%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 15/24 (63%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
| LOC110439525 | XP_021331300.1 | COG5048 | <70..360 | CDD:227381 | 66/171 (39%) |
| C2H2 Zn finger | 103..123 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 131..151 | CDD:275368 | 13/19 (68%) | ||
| C2H2 Zn finger | 159..179 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 187..207 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 215..235 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 243..263 | CDD:275368 | |||
| C2H2 Zn finger | 271..291 | CDD:275368 | |||
| C2H2 Zn finger | 299..319 | CDD:275368 | |||
| C2H2 Zn finger | 327..347 | CDD:275368 | |||
| C2H2 Zn finger | 412..432 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588370 | |
| Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12423 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.840 | |||||