DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and zgc:173607

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001315634.1 Gene:zgc:173607 / 108183284 ZFINID:ZDB-GENE-080219-15 Length:350 Species:Danio rerio


Alignment Length:317 Identity:87/317 - (27%)
Similarity:125/317 - (39%) Gaps:92/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 CSGC----------SVHK--EDGMPQFICVECAEAVRNAYRLR--------------RQCRKSHQ 83
            |:.|          .:|.  ..|...|.|.:|.::...:..|.              .||.||  
Zfish    59 CTQCGKSFGGNGNLKIHMMIHTGEKPFTCTQCGKSFSQSSHLNDHMMIHTGEKPFTCTQCGKS-- 121

  Fly    84 YFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISS 148
             |.:|.|:.:.:     .::.|:.     |.|..:.||:...|..|                   
Zfish   122 -FIRLSLLNQHM-----MIHTGEK-----PFSCTQCGKSFRQSSYL------------------- 156

  Fly   149 PLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSW---SPDSELE-HEDDDKIWNASKRGKPK 209
                 |||.:.         |...|    .::....|   |..|:|. |.   :|....|     
Zfish   157 -----NEHMMI---------HTGEK----PFTCTQCWKSFSRSSDLNLHM---RIHTGEK----- 195

  Fly   210 RVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCP 274
                |:.|..|.:||:...:|..||||||||:|:.|:.|.:||:|..:|..|...||||:.|.|.
Zfish   196 ----PFTCTQCGKSFSCSSSLNKHMRIHTGEKPFTCTQCGKSFSQSSDLNKHMMIHTGEKSFTCT 256

  Fly   275 NCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQ 331
            .|.|.|.:...|..|.|.||||:||.|:||.:||...:.|.:||..||..|..|.:|
Zfish   257 QCGKTFSRSSNLNQHMRIHTGEKPFTCTKCGKSFNCSSHLNRHMRNHTGEKLFTCTQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 13/68 (19%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zgc:173607NP_001315634.1 C2H2 Zn finger 59..79 CDD:275368 3/19 (16%)
zf-H2C2_2 71..96 CDD:290200 5/24 (21%)
COG5048 83..>331 CDD:227381 83/293 (28%)
C2H2 Zn finger 87..107 CDD:275368 3/19 (16%)
zf-H2C2_2 99..124 CDD:290200 6/27 (22%)
C2H2 Zn finger 115..135 CDD:275368 7/27 (26%)
zf-H2C2_2 128..152 CDD:290200 5/33 (15%)
C2H2 Zn finger 143..163 CDD:275368 7/52 (13%)
zf-H2C2_2 155..180 CDD:290200 7/61 (11%)
C2H2 Zn finger 171..191 CDD:275368 5/22 (23%)
zf-H2C2_2 183..208 CDD:290200 9/36 (25%)
C2H2 Zn finger 199..219 CDD:275368 8/19 (42%)
zf-H2C2_2 211..236 CDD:290200 14/24 (58%)
C2H2 Zn finger 227..247 CDD:275368 7/19 (37%)
zf-H2C2_2 239..264 CDD:290200 11/24 (46%)
C2H2 Zn finger 255..275 CDD:275368 7/19 (37%)
zf-H2C2_2 267..292 CDD:290200 14/24 (58%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
zf-H2C2_2 295..320 CDD:290200 8/19 (42%)
C2H2 Zn finger 311..331 CDD:275368 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.