DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and LOC108182686

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_017210033.1 Gene:LOC108182686 / 108182686 -ID:- Length:420 Species:Danio rerio


Alignment Length:131 Identity:59/131 - (45%)
Similarity:75/131 - (57%) Gaps:2/131 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SKRGKPKRVPG--PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCH 265
            |..|:|::...  .:.||.|.:||:||.||::|||:||.|:||.|..|.:||.|....::|.|.|
Zfish    68 SSHGRPRKSKSGCNFSCKQCRKSFSQKSNLDVHMRVHTREQPYTCEQCGKSFGQIQGFKAHMRIH 132

  Fly   266 TGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSS 330
            ||||.|.|..|.|.|..||....|.|.||||:||.|.:|.:||.....|..||..||..|..|..
Zfish   133 TGERKFTCQECGKSFYHVGNFAAHMRIHTGEKPFSCEQCGKSFCHKPNLDVHMRVHTGEKPYTCE 197

  Fly   331 Q 331
            |
Zfish   198 Q 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 12/21 (57%)
C2H2 Zn finger 217..237 CDD:275368 12/19 (63%)
zf-H2C2_2 229..254 CDD:290200 14/24 (58%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
LOC108182686XP_017210033.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588347
Domainoid 1 1.000 42 1.000 Domainoid score I12423
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.