| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009299259.1 | Gene: | si:cabz01054394.7 / 103910994 | ZFINID: | ZDB-GENE-161017-111 | Length: | 353 | Species: | Danio rerio |
| Alignment Length: | 203 | Identity: | 76/203 - (37%) |
|---|---|---|---|
| Similarity: | 102/203 - (50%) | Gaps: | 18/203 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 ETSEPLLV-ELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSP 187
Fly 188 DSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSF 252
Fly 253 AQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKH 317
Fly 318 MSAHTRGK 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 15/24 (63%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 6/19 (32%) | ||
| si:cabz01054394.7 | XP_009299259.1 | COG5048 | <37..233 | CDD:227381 | 65/171 (38%) |
| C2H2 Zn finger | 83..103 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 95..120 | CDD:290200 | 15/24 (63%) | ||
| C2H2 Zn finger | 111..131 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 123..148 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 151..176 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 180..204 | CDD:290200 | 5/12 (42%) | ||
| C2H2 Zn finger | 195..215 | CDD:275368 | |||
| zf-H2C2_2 | 207..232 | CDD:290200 | |||
| zf-C2H2 | 221..243 | CDD:278523 | |||
| C2H2 Zn finger | 223..243 | CDD:275368 | |||
| zf-H2C2_2 | 235..258 | CDD:290200 | |||
| C2H2 Zn finger | 251..271 | CDD:275368 | |||
| C2H2 Zn finger | 279..299 | CDD:275368 | |||
| C2H2 Zn finger | 307..327 | CDD:275370 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588360 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||