DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17359 and znf1140

DIOPT Version :9

Sequence 1:	NP_648679.1	Gene:	CG17359 / 39549	FlyBaseID:	FBgn0036396	Length:	339	Species:	Drosophila melanogaster
Sequence 2:	NP_001315631.1	Gene:	znf1140 / 103910465	ZFINID:	ZDB-GENE-080218-12	Length:	363	Species:	Danio rerio

Alignment Length:	111	Identity:	53/111 - (47%)
Similarity:	68/111 - (61%)	Gaps:	0/111 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   215 YRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKR 279
            |.|:.|.:|.:...|..:|||||||||||.|..|.:||...||..:|||.||||:|:.||.|.|.
Zfish   137 YTCQQCGKSCSNAGNFAVHMRIHTGERPYTCQQCGKSFTHAGNCAAHTRIHTGEKPYSCPQCGKS 201

  Fly   280 FRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGK 325
            |||.|.|:.|.:||.||:.|.|::|.:.|.:......||..||..|
Zfish   202 FRQKGNLETHMKTHKGERSFTCTQCGKCFLKKQNFNNHMRIHTGEK 247

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17359	NP_648679.1	zf-AD	6..88	CDD:285071
		zf-C2H2	215..237	CDD:278523	8/21 (38%)
		C2H2 Zn finger	217..237	CDD:275368	7/19 (37%)
		zf-H2C2_2	229..254	CDD:290200	16/24 (67%)
		C2H2 Zn finger	245..265	CDD:275368	9/19 (47%)
		zf-H2C2_2	257..282	CDD:290200	14/24 (58%)
		C2H2 Zn finger	273..293	CDD:275368	10/19 (53%)
		zf-H2C2_2	286..310	CDD:290200	10/23 (43%)
		C2H2 Zn finger	301..321	CDD:275368	5/19 (26%)
znf1140	NP_001315631.1	C2H2 Zn finger	83..103	CDD:275368
		zf-H2C2_2	98..118	CDD:290200
		C2H2 Zn finger	111..131	CDD:275368
		C2H2 Zn finger	139..159	CDD:275368	7/19 (37%)
		COG5048	<144..321	CDD:227381	50/104 (48%)
		zf-H2C2_2	151..176	CDD:290200	16/24 (67%)
		C2H2 Zn finger	167..187	CDD:275368	9/19 (47%)
		zf-H2C2_2	183..204	CDD:290200	13/20 (65%)
		C2H2 Zn finger	195..215	CDD:275368	10/19 (53%)
		zf-H2C2_2	207..230	CDD:290200	9/22 (41%)
		C2H2 Zn finger	223..243	CDD:275368	5/19 (26%)
		C2H2 Zn finger	251..271	CDD:275368
		zf-H2C2_2	264..288	CDD:290200
		C2H2 Zn finger	279..296	CDD:275368
		C2H2 Zn finger	307..327	CDD:275368
		C2H2 Zn finger	335..355	CDD:275370
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170588351
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930