DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and LOC100537891

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_017209964.1 Gene:LOC100537891 / 100537891 -ID:- Length:362 Species:Danio rerio


Alignment Length:193 Identity:62/193 - (32%)
Similarity:88/193 - (45%) Gaps:35/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 HNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGP--YRCKLCTQSFTQKQNLE 231
            |..::|..:.:..:...:.|     |........|..|.|::....  :.|..|...||:|.||:
Zfish    38 HQWNEREEKQFEKHQETTTD-----EKPTLTEKTSSCGGPRKSKSACNFTCLQCGNCFTRKHNLQ 97

  Fly   232 IHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTG- 295
            :|||:||||:||.|..|.:||.|.|.|:.|.|.|||||.:.|..|.:||...|....|.|.||| 
Zfish    98 VHMRVHTGEKPYSCPQCGKSFKQNGYLKVHMRTHTGERCYTCQQCGQRFYTTGNFAQHMRIHTGG 162

  Fly   296 ---------------------------EQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQ 331
                                       |:|:.|.:|.:||||.:.|:.|:.||..|:..|..|
Zfish   163 RLYTCLQCGKSLYQSANLAAHRRIHTVEKPYSCIQCGKSFKQNSTLEAHIRAHDDGRIFTCPQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 10/21 (48%)
C2H2 Zn finger 217..237 CDD:275368 10/19 (53%)
zf-H2C2_2 229..254 CDD:290200 15/24 (63%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 12/24 (50%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 11/51 (22%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
LOC100537891XP_017209964.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.