Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009301501.1 | Gene: | LOC100537431 / 100537431 | -ID: | - | Length: | 434 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 74/197 - (37%) |
---|---|---|---|
Similarity: | 95/197 - (48%) | Gaps: | 26/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 EHKLAQ---SYSPAKTPHNKSKRRAR---------SYSDNDSWSPDSELEHEDDDKIWNASKRGK 207
Fly 208 P-KRVPG------------PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQ 259
Fly 260 SHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRG 324
Fly 325 KR 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 13/21 (62%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 13/19 (68%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
LOC100537431 | XP_009301501.1 | COG5048 | 73..433 | CDD:227381 | 66/168 (39%) |
C2H2 Zn finger | 103..123 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 116..140 | CDD:290200 | 6/23 (26%) | ||
C2H2 Zn finger | 131..151 | CDD:275368 | 13/19 (68%) | ||
zf-H2C2_2 | 143..168 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 159..179 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 174..194 | CDD:290200 | 11/19 (58%) | ||
C2H2 Zn finger | 187..207 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 199..222 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 215..235 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 227..252 | CDD:290200 | 6/14 (43%) | ||
C2H2 Zn finger | 243..263 | CDD:275368 | |||
zf-H2C2_2 | 256..280 | CDD:290200 | |||
C2H2 Zn finger | 271..291 | CDD:275368 | |||
zf-H2C2_2 | 283..308 | CDD:290200 | |||
C2H2 Zn finger | 299..319 | CDD:275368 | |||
zf-H2C2_2 | 311..334 | CDD:290200 | |||
zf-C2H2 | 325..347 | CDD:278523 | |||
C2H2 Zn finger | 327..347 | CDD:275368 | |||
zf-H2C2_2 | 339..364 | CDD:290200 | |||
C2H2 Zn finger | 383..404 | CDD:275368 | |||
C2H2 Zn finger | 412..432 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588265 | |
Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12423 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |