| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_003198538.1 | Gene: | LOC100536900 / 100536900 | -ID: | - | Length: | 359 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 75/201 - (37%) |
|---|---|---|---|
| Similarity: | 99/201 - (49%) | Gaps: | 20/201 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 158 LAQSYSPAKTPH-NKSKRRARSYSDNDSWSPDSELE-----HEDDDKIWNASKRGKP-------- 208
Fly 209 --KRV---PGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGE 268
Fly 269 RPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQET 333
Fly 334 KRNKFK 339 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
| zf-C2H2 | 215..237 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 6/19 (32%) | ||
| LOC100536900 | XP_003198538.1 | COG5048 | <54..336 | CDD:227381 | 75/201 (37%) |
| C2H2 Zn finger | 107..127 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 119..142 | CDD:290200 | 6/22 (27%) | ||
| C2H2 Zn finger | 135..155 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 147..170 | CDD:290200 | 14/22 (64%) | ||
| C2H2 Zn finger | 163..183 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 175..200 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 191..211 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 219..239 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 231..256 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 247..267 | CDD:275368 | 2/11 (18%) | ||
| zf-H2C2_2 | 260..284 | CDD:290200 | |||
| C2H2 Zn finger | 275..295 | CDD:275368 | |||
| C2H2 Zn finger | 331..351 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170588299 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||