DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17359 and LOC100535113

DIOPT Version :9

Sequence 1:	NP_648679.1	Gene:	CG17359 / 39549	FlyBaseID:	FBgn0036396	Length:	339	Species:	Drosophila melanogaster
Sequence 2:	XP_003198560.1	Gene:	LOC100535113 / 100535113	-ID:	-	Length:	331	Species:	Danio rerio

Alignment Length:	190	Identity:	62/190 - (32%)
Similarity:	86/190 - (45%)	Gaps:	39/190 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   181 DNDSWSPDSELEHEDDDKIW---------NASKRGKPKRVPGP--YRCKLCTQSFTQKQNLEIHM 234
            :...|:...|.:.|...:|.         ..|..|.|::....  :.|..|...||:|.||::||
Zfish     5 EETQWNKTEEKQFEKHQEITTDEKPTLTEKTSSSGGPRKSKSACNFTCVQCGNCFTRKHNLQVHM 69

  Fly   235 RIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTG---- 295
            |:||||:||.|..|.:||.|.|.|:.|.|.|||||.:.|..|.:||...|....|.|.|||
Zfish    70 RVHTGEKPYSCPQCGKSFKQNGYLKVHMRTHTGERCYTCQQCGQRFYTTGNFAQHMRIHTGERPY 134

  Fly   296 ------------------------EQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQ 331
                                    |:|:.|.:|.:||||.:.|:.|:.||..|:..|..|
Zfish   135 ICLQCGKSLYQSANLAAHMRIHTVEKPYSCIQCGKSFKQNSSLEAHIRAHDDGRIFTCPQ 194

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17359	NP_648679.1	zf-AD	6..88	CDD:285071
		zf-C2H2	215..237	CDD:278523	10/21 (48%)
		C2H2 Zn finger	217..237	CDD:275368	10/19 (53%)
		zf-H2C2_2	229..254	CDD:290200	15/24 (63%)
		C2H2 Zn finger	245..265	CDD:275368	9/19 (47%)
		zf-H2C2_2	257..282	CDD:290200	12/24 (50%)
		C2H2 Zn finger	273..293	CDD:275368	7/19 (37%)
		zf-H2C2_2	286..310	CDD:290200	11/51 (22%)
		C2H2 Zn finger	301..321	CDD:275368	8/19 (42%)
LOC100535113	XP_003198560.1	COG5048	<50..232	CDD:227381	55/145 (38%)
		C2H2 Zn finger	52..72	CDD:275368	10/19 (53%)
		zf-H2C2_2	64..89	CDD:290200	15/24 (63%)
		C2H2 Zn finger	80..100	CDD:275368	9/19 (47%)
		C2H2 Zn finger	108..128	CDD:275368	7/19 (37%)
		C2H2 Zn finger	136..156	CDD:275368	0/19 (0%)
		zf-H2C2_2	148..173	CDD:290200	6/24 (25%)
		COG5048	<160..297	CDD:227381	14/35 (40%)
		C2H2 Zn finger	164..184	CDD:275368	8/19 (42%)
		C2H2 Zn finger	192..212	CDD:275368	1/3 (33%)
		zf-H2C2_2	204..227	CDD:290200
		C2H2 Zn finger	220..240	CDD:275368
		zf-H2C2_2	233..257	CDD:290200
		C2H2 Zn finger	248..268	CDD:275368
		C2H2 Zn finger	276..296	CDD:275368
		C2H2 Zn finger	303..323	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170588269
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930