Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314962.1 | Gene: | si:ch73-266f23.3 / 100333922 | ZFINID: | ZDB-GENE-110914-182 | Length: | 300 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 79/232 - (34%) |
---|---|---|---|
Similarity: | 110/232 - (47%) | Gaps: | 35/232 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 SVMEAGKTP----------------ETSEPLLV-ELVQVKYMPPEPKPISSPLPDNNE-HKLAQS 161
Fly 162 YSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQ 226
Fly 227 KQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTR 291
Fly 292 THTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRT 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 13/21 (62%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 8/19 (42%) | ||
si:ch73-266f23.3 | NP_001314962.1 | C2H2 Zn finger | 84..104 | CDD:275368 | 2/31 (6%) |
zf-H2C2_2 | 96..121 | CDD:290200 | 9/29 (31%) | ||
COG5048 | <109..275 | CDD:227381 | 59/115 (51%) | ||
C2H2 Zn finger | 112..132 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 124..149 | CDD:290200 | 15/24 (63%) | ||
zf-C2H2 | 138..160 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 140..160 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 152..177 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 168..188 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 196..216 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 223..244 | CDD:278523 | 1/1 (100%) | ||
C2H2 Zn finger | 224..244 | CDD:275368 | 79/232 (34%) | ||
C2H2 Zn finger | 252..272 | CDD:275368 | |||
C2H2 Zn finger | 280..300 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588315 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |