DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and LOC100150619

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001314928.1 Gene:LOC100150619 / 100150619 -ID:- Length:392 Species:Danio rerio


Alignment Length:146 Identity:61/146 - (41%)
Similarity:81/146 - (55%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPK 278
            |:.||.|.:||:||.|||||||:||||:||.|..|.:||:||..|::|.|.||||:||.|..|.|
Zfish   165 PFSCKQCGKSFSQKSNLEIHMRVHTGEKPYTCEQCGKSFSQKQCLKTHMRTHTGEKPFSCKQCRK 229

  Fly   279 RF---------------------RQVGQ-------LQVHTRTHTGEQPFKCSKCQQSFKQLNGLQ 315
            .|                     .|.|:       |.:|.|.||||:|:.|::|.:||...:.|:
Zfish   230 SFSKKLTLIAHIRVHTREKPYTCEQCGKSLGKKQDLYIHMRIHTGEKPYTCTECGKSFPHKSSLK 294

  Fly   316 KHMSAHTRGKRRTSSQ 331
            .||..||..|..|..:
Zfish   295 HHMRTHTGEKPFTCDE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 14/21 (67%)
C2H2 Zn finger 217..237 CDD:275368 14/19 (74%)
zf-H2C2_2 229..254 CDD:290200 17/24 (71%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 13/45 (29%)
C2H2 Zn finger 273..293 CDD:275368 9/47 (19%)
zf-H2C2_2 286..310 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
LOC100150619NP_001314928.1 C2H2 Zn finger 84..104 CDD:275368
C2H2 Zn finger 112..132 CDD:275368
C2H2 Zn finger 140..160 CDD:275368
zf-H2C2_2 152..177 CDD:290200 6/11 (55%)
COG5048 <164..324 CDD:227381 61/146 (42%)
C2H2 Zn finger 168..188 CDD:275368 14/19 (74%)
zf-H2C2_2 180..205 CDD:290200 17/24 (71%)
C2H2 Zn finger 196..216 CDD:275368 9/19 (47%)
zf-H2C2_2 209..232 CDD:290200 12/22 (55%)
C2H2 Zn finger 224..244 CDD:275368 4/19 (21%)
C2H2 Zn finger 252..272 CDD:275368 5/19 (26%)
zf-H2C2_2 264..287 CDD:290200 10/22 (45%)
COG5048 276..>385 CDD:227381 12/35 (34%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
zf-H2C2_2 292..317 CDD:290200 7/19 (37%)
C2H2 Zn finger 308..328 CDD:275368 0/3 (0%)
C2H2 Zn finger 336..356 CDD:275368
C2H2 Zn finger 364..384 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588273
Domainoid 1 1.000 42 1.000 Domainoid score I12423
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.