DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and LOC100149352

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_021330976.1 Gene:LOC100149352 / 100149352 -ID:- Length:238 Species:Danio rerio


Alignment Length:213 Identity:64/213 - (30%)
Similarity:97/213 - (45%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ETSEPL-LVELVQVKYMPPEP----KPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSD-- 181
            |.||.| :.|:..:|....|.    ||::..:.:.||.|             :.|.:...:.|  
Zfish    15 EESEDLRIAEVFSLKQEDIEEQIDLKPLNEEIQEPNEIK-------------EEKNQLEEHHDFI 66

  Fly   182 ---NDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPY 243
               .:|.||..|....:..:..|:.           :.|:.|.:||.::.:|:.|.|.||||..:
Zfish    67 TVEQNSCSPTDERTTRETSQNTNSG-----------FSCQRCGKSFVKEGHLKNHSRTHTGESSF 120

  Fly   244 KCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSF 308
            .|..|.:.|.||.||::||:.|..|....|..|.|||:.....:.|.|.|:||:|.||..|.:||
Zfish   121 TCKQCGKGFTQKANLRNHTKLHAEESALFCQQCGKRFKLKKDFRRHMRGHSGEKPHKCLHCGKSF 185

  Fly   309 KQLNGLQKHMSAHTRGKR 326
            ...:....|||.|| |:|
Zfish   186 IDKSSANVHMSVHT-GER 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 10/24 (42%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 11/24 (46%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
LOC100149352XP_021330976.1 C2H2 Zn finger 94..114 CDD:275368 7/19 (37%)
zf-H2C2_2 106..131 CDD:316026 10/24 (42%)
C2H2 Zn finger 122..142 CDD:275368 9/19 (47%)
C2H2 Zn finger 150..170 CDD:275368 7/19 (37%)
zf-H2C2_2 162..185 CDD:316026 9/22 (41%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
C2H2 Zn finger 206..226 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.