Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021330976.1 | Gene: | LOC100149352 / 100149352 | -ID: | - | Length: | 238 | Species: | Danio rerio |
Alignment Length: | 213 | Identity: | 64/213 - (30%) |
---|---|---|---|
Similarity: | 97/213 - (45%) | Gaps: | 35/213 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 ETSEPL-LVELVQVKYMPPEP----KPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSD-- 181
Fly 182 ---NDSWSPDSELEHEDDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPY 243
Fly 244 KCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSF 308
Fly 309 KQLNGLQKHMSAHTRGKR 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | |
zf-C2H2 | 215..237 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 7/19 (37%) | ||
LOC100149352 | XP_021330976.1 | C2H2 Zn finger | 94..114 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 106..131 | CDD:316026 | 10/24 (42%) | ||
C2H2 Zn finger | 122..142 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 150..170 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 162..185 | CDD:316026 | 9/22 (41%) | ||
C2H2 Zn finger | 178..198 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 206..226 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588349 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |