| Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001116087.1 | Gene: | zgc:174646 / 100142637 | ZFINID: | ZDB-GENE-080305-6 | Length: | 408 | Species: | Danio rerio |
| Alignment Length: | 328 | Identity: | 87/328 - (26%) |
|---|---|---|---|
| Similarity: | 133/328 - (40%) | Gaps: | 93/328 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 RDESDCLLDIYTEPYASSNRVQ-------EQEPVLATMLRECSGCSVHKEDGMPQFICVECAEAV 68
Fly 69 RNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVEL 133
Fly 134 VQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDK 198
Fly 199 IWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTR 263
Fly 264 CHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRT 328
Fly 329 SSQ 331 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 16/83 (19%) |
| zf-C2H2 | 215..237 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 229..254 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 257..282 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 8/19 (42%) | ||
| zgc:174646 | NP_001116087.1 | C2H2 Zn finger | 68..88 | CDD:275368 | 8/41 (20%) |
| zf-H2C2_2 | 81..105 | CDD:290200 | 7/36 (19%) | ||
| C2H2 Zn finger | 96..116 | CDD:275368 | 6/43 (14%) | ||
| zf-H2C2_2 | 108..132 | CDD:290200 | 7/51 (14%) | ||
| C2H2 Zn finger | 124..144 | CDD:275368 | 6/31 (19%) | ||
| COG5048 | <129..391 | CDD:227381 | 58/159 (36%) | ||
| zf-H2C2_2 | 137..161 | CDD:290200 | 7/35 (20%) | ||
| C2H2 Zn finger | 152..172 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 164..187 | CDD:290200 | 13/22 (59%) | ||
| C2H2 Zn finger | 180..200 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 192..216 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 221..245 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 248..272 | CDD:290200 | 7/19 (37%) | ||
| C2H2 Zn finger | 264..284 | CDD:275368 | 1/3 (33%) | ||
| zf-H2C2_2 | 276..301 | CDD:290200 | |||
| C2H2 Zn finger | 292..312 | CDD:275368 | |||
| C2H2 Zn finger | 320..340 | CDD:275368 | |||
| zf-H2C2_2 | 332..356 | CDD:290200 | |||
| C2H2 Zn finger | 348..368 | CDD:275368 | |||
| C2H2 Zn finger | 375..395 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||