DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17359 and zgc:174314

DIOPT Version :9

Sequence 1:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001107958.1 Gene:zgc:174314 / 100007842 ZFINID:ZDB-GENE-080213-5 Length:359 Species:Danio rerio


Alignment Length:181 Identity:72/181 - (39%)
Similarity:96/181 - (53%) Gaps:15/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRVPG-------------PYRCKLCTQS 223
            ||:|.:::|.....  |..:.....:|.....:.||.....|             ||.|:.|.:|
Zfish    79 SKQRRKTFSQKPKL--DVHMRVHTGEKPCTCKQCGKSFYTIGNLTVHMRIHTGEKPYTCEQCGKS 141

  Fly   224 FTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQV 288
            |.:|:|.:.|||||||||||.|..|.:||...|||..|.|.||.|||:.||.|.|.|:|.|.|:|
Zfish   142 FCKKENFKTHMRIHTGERPYTCQQCGKSFYHSGNLIMHMRIHTEERPYSCPQCGKSFKQNGNLEV 206

  Fly   289 HTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQETKRNKFK 339
            |.||||||:.|.|::|.:||.:...|..||..||..|..|.::..|...:|
Zfish   207 HMRTHTGEKRFTCTQCGKSFVKKQNLDIHMRIHTGEKPYTCTECGKSFTYK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17359NP_648679.1 zf-AD 6..88 CDD:285071
zf-C2H2 215..237 CDD:278523 10/21 (48%)
C2H2 Zn finger 217..237 CDD:275368 9/19 (47%)
zf-H2C2_2 229..254 CDD:290200 16/24 (67%)
C2H2 Zn finger 245..265 CDD:275368 9/19 (47%)
zf-H2C2_2 257..282 CDD:290200 14/24 (58%)
C2H2 Zn finger 273..293 CDD:275368 11/19 (58%)
zf-H2C2_2 286..310 CDD:290200 14/23 (61%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zgc:174314NP_001107958.1 COG5048 <71..263 CDD:227381 72/181 (40%)
zf-H2C2_2 92..116 CDD:290200 4/25 (16%)
C2H2 Zn finger 107..127 CDD:275368 3/19 (16%)
zf-H2C2_2 119..142 CDD:290200 4/22 (18%)
C2H2 Zn finger 135..155 CDD:275368 9/19 (47%)
zf-H2C2_2 147..170 CDD:290200 14/22 (64%)
C2H2 Zn finger 163..183 CDD:275368 9/19 (47%)
zf-H2C2_2 175..200 CDD:290200 14/24 (58%)
C2H2 Zn finger 191..211 CDD:275368 11/19 (58%)
zf-H2C2_2 203..227 CDD:290200 13/23 (57%)
COG5048 219..>359 CDD:227381 13/39 (33%)
C2H2 Zn finger 219..239 CDD:275368 7/19 (37%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 2/11 (18%)
zf-H2C2_2 259..284 CDD:290200
C2H2 Zn finger 275..295 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.