Sequence 1: | NP_648679.1 | Gene: | CG17359 / 39549 | FlyBaseID: | FBgn0036396 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314790.1 | Gene: | si:ch211-161m3.6 / 100005838 | ZFINID: | ZDB-GENE-161017-36 | Length: | 295 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 84/263 - (31%) |
---|---|---|---|
Similarity: | 121/263 - (46%) | Gaps: | 53/263 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 LRLMMKELDDIE----YCLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISS 148
Fly 149 PLPDNNEHKL--AQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIWNASKRGKPKRV 211
Fly 212 PG-------------PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTR 263
Fly 264 CHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRGKRRT 328
Fly 329 SSQ 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17359 | NP_648679.1 | zf-AD | 6..88 | CDD:285071 | 84/263 (32%) |
zf-C2H2 | 215..237 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 229..254 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 257..282 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 286..310 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 9/19 (47%) | ||
si:ch211-161m3.6 | NP_001314790.1 | COG5048 | <65..234 | CDD:227381 | 67/180 (37%) |
zf-C2H2 | 85..107 | CDD:278523 | 3/21 (14%) | ||
C2H2 Zn finger | 87..107 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 99..124 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 115..135 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 127..152 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 143..163 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 155..179 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 171..191 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 183..208 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 199..219 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 211..236 | CDD:290200 | 8/19 (42%) | ||
C2H2 Zn finger | 227..247 | CDD:275368 | 1/3 (33%) | ||
zf-H2C2_2 | 239..264 | CDD:290200 | |||
C2H2 Zn finger | 255..271 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588363 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |