DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and AT1G06260

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_563764.1 Gene:AT1G06260 / 837137 AraportID:AT1G06260 Length:343 Species:Arabidopsis thaliana


Alignment Length:317 Identity:114/317 - (35%)
Similarity:158/317 - (49%) Gaps:18/317 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DEH--VDKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKNRAKLTYTLAVNHLADKTEEE 300
            |.|  :.:.|..:.:.|...|....|...|..|::.|::.|...|...|.:.|..|..||.|..|
plant    34 DPHKTLKQRFEKWLKTHSKLYGGRDEWMLRFGIYQSNVQLIDYINSLHLPFKLTDNRFADMTNSE 98

  Fly   301 LKAR-RGYKSSGIYNTGKPFPYDVPKYKDEIPDQYDWRLYGAVTPVKDQSVCGSCWSFGTIGHLE 364
            .||. .|..:|.:....|..|...|  ...:||..|||..|||||:::|..||.||:|..:..:|
plant    99 FKAHFLGLNTSSLRLHKKQRPVCDP--AGNVPDAVDWRTQGAVTPIRNQGKCGGCWAFSAVAAIE 161

  Fly   365 GAFFLKNGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQSGGVPTEEEYGPYLGQDGYC 429
            |...:|. ||||.||:|.||||.....|.||.||.....::::..:||:.||.:| ||.|.:|.|
plant   162 GINKIKT-GNLVSLSEQQLIDCDVGTYNKGCSGGLMETAFEFIKTNGGLATETDY-PYTGIEGTC 224

  Fly   430 -HVNNVTLVAPIKGFVNVTSNDPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVD 493
             ...:...|..|:|:..|..|:. :.::|..:. |:||.|||....|..||.||:......|   
plant   225 DQEKSKNKVVTIQGYQKVAQNEA-SLQIAAAQQ-PVSVGIDAGGFIFQLYSSGVFTNYCGTN--- 284

  Fly   494 GLDHAVLAVGYGSINGEDYWLVKNSWSTYWGNDGYILM----SAKKNNCGVMTMPTY 546
             |:|.|..||||....:.||:|||||.|.||.:|||.|    |.....||:..|.:|
plant   285 -LNHGVTVVGYGVEGDQKYWIVKNSWGTGWGEEGYIRMERGVSEDTGKCGIAMMASY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 15/54 (28%)
Peptidase_C1A 331..547 CDD:239068 89/221 (40%)
AT1G06260NP_563764.1 Inhibitor_I29 43..98 CDD:214853 15/54 (28%)
Peptidase_C1 127..341 CDD:365882 89/222 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.