DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and Ctso

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:XP_038959660.1 Gene:Ctso / 684529 RGDID:1589156 Length:311 Species:Rattus norvegicus


Alignment Length:287 Identity:84/287 - (29%)
Similarity:126/287 - (43%) Gaps:36/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 RQNL---RYIHSKNRAKLTYTLAVNHLADKTEEELKARRGYKSSGIYNTGKP-----FPY--DVP 324
            |::|   ||::|......|....||..:....||.||        :|...||     :|.  ..|
  Rat    36 RESLNRHRYLNSFPHDNSTAFYGVNQFSYLFPEEFKA--------LYLGSKPAWAPRYPAKGQTP 92

  Fly   325 KYKDEIPDQYDWRLYGAVTPVKDQSVCGSCWSFGTIGHLEGAFFLKNGGNLVRLSQQALIDCSWA 389
            .....:|.::|||....|..|::|..||.||:|..:..:|.|..:: |..|..||.|.:||||  
  Rat    93 IPNVSLPLRFDWRDKHVVNHVRNQKTCGGCWAFSVVSAVESAGAIQ-GKPLDYLSVQQVIDCS-- 154

  Fly   390 YGNNGCDGGEDFRVYQWMLQSGGVPTEEEYGPYLGQDGYCHV-----NNVTLVAPIKGFVNVT-S 448
            :.|.||.||.......|:.::......:...|:..::|.|..     :.|:    :|||.... |
  Rat   155 FNNYGCRGGSPLGALSWLNETQLKLVADSQYPFKAENGLCRYFPPSQSGVS----VKGFSAYDFS 215

  Fly   449 NDPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYGSINGEDYW 513
            |..:....|||..|||.|.:||  .::..|..|:........:.   :||||..|:.......||
  Rat   216 NQEDEMARALLSFGPLVVIVDA--VSWQDYLGGIIQHHCSSGEA---NHAVLITGFDKTGNTPYW 275

  Fly   514 LVKNSWSTYWGNDGYILMSAKKNNCGV 540
            :|:|||...||.:||..:....|.||:
  Rat   276 MVRNSWGNSWGVEGYAYVKMGGNVCGI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 8/32 (25%)
Peptidase_C1A 331..547 CDD:239068 67/216 (31%)
CtsoXP_038959660.1 Peptidase_C1A 99..304 CDD:239068 67/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.