DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and Ctsz

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_071720.1 Gene:Ctsz / 64138 MGIID:1891190 Length:306 Species:Mus musculus


Alignment Length:269 Identity:76/269 - (28%)
Similarity:121/269 - (44%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 LKARRGYKSSGIYNTGKPFPYDVPKYKDEIPDQYDWR-----LYGAVTPVKDQSV---CGSCWSF 357
            |..||.|.        :|..|..|.   ::|..:|||     .|.:||  ::|.:   |||||:.
Mouse    46 LLGRRTYP--------RPHEYLSPA---DLPKNWDWRNVNGVNYASVT--RNQHIPQYCGSCWAH 97

  Fly   358 GTIGHLEGAFFLKNGG--NLVRLSQQALIDCSWAYGNNG-CDGGEDFRVYQWMLQSGGVPTEEEY 419
            |:...:.....:|..|  ..:.||.|.:|||    ||.| |:||.|..|::: ....|:| :|..
Mouse    98 GSTSAMADRINIKRKGAWPSILLSVQNVIDC----GNAGSCEGGNDLPVWEY-AHKHGIP-DETC 156

  Fly   420 GPYLGQD---------------GYCH-VNNVTLVAPIKGFVNVTSNDPNAFKLALLKHGPLSVAI 468
            ..|..:|               ..|| :.|.||.. :..:.:::..:  .....:..:||:|..|
Mouse   157 NNYQAKDQDCDKFNQCGTCTEFKECHTIQNYTLWR-VGDYGSLSGRE--KMMAEIYANGPISCGI 218

  Fly   469 DASPKTFSFYSHGVYYEPTCKNDVDGLDHAVLAVGYG-SINGEDYWLVKNSWSTYWGNDGY--IL 530
            .|: :..|.|:.|:|.|   ..|...::|.:...|:| |.:|.:||:|:|||...||..|:  |:
Mouse   219 MAT-EMMSNYTGGIYAE---HQDQAVINHIISVAGWGVSNDGIEYWIVRNSWGEPWGEKGWMRIV 279

  Fly   531 MSAKKNNCG 539
            .|..|...|
Mouse   280 TSTYKGGTG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853
Peptidase_C1A 331..547 CDD:239068 69/239 (29%)
CtszNP_071720.1 Peptidase_C1A_CathepsinX 64..305 CDD:239149 69/240 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.