DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and ctsf

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001071036.1 Gene:ctsf / 565588 ZFINID:ZDB-GENE-030131-9831 Length:473 Species:Danio rerio


Alignment Length:326 Identity:105/326 - (32%)
Similarity:156/326 - (47%) Gaps:34/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 PMQEFISGTDEHVDKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLR---YIHSKNRAKLTYTLAV 290
            ||:|.:     .:...|.:|...:...|.|..|.|.|..||:||::   .:.|..:....|  .:
Zfish   164 PMKESV-----ELLTMFKNFMITYNRTYSSQEEAEKRLRIFQQNMKTAQTLQSLEQGSAEY--GI 221

  Fly   291 NHLADKTEEELKARRGYKSS-----GIYNTGKP-FPYDVPKYKDEIPDQYDWRLYGAVTPVKDQS 349
            ...:|.||:|.  |..|.:.     .:....|| .|...|     .||.:|||.:|||:|||:|.
Zfish   222 TKFSDLTEDEF--RMMYLNPMLSQWSLKKEMKPAIPASAP-----APDTWDWRDHGAVSPVKNQG 279

  Fly   350 VCGSCWSFGTIGHLEGAFFLKNGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWMLQSGGVP 414
            :|||||:|...|::||.:| |..|.|:.||:|.|:||...  :..|.||.....|:.:...||:.
Zfish   280 MCGSCWAFSVTGNIEGQWF-KKTGQLLSLSEQELVDCDKL--DQACGGGLPSNAYEAIENLGGLE 341

  Fly   415 TEEEYGPYLGQDGYCHVNNVTLVAPIKGFVNVTSNDPN--AFKLALLKHGPLSVAIDASPKTFSF 477
            ||.:|. |.|....|..:...:.|.|...|.:..::..  ||   |.::||:|.|::|.  ...|
Zfish   342 TETDYS-YTGHKQSCDFSTGKVAAYINSSVELPKDEKEIAAF---LAENGPVSAALNAF--AMQF 400

  Fly   478 YSHGVYYEPTCKNDVDGLDHAVLAVGYGSINGEDYWLVKNSWSTYWGNDGYILMSAKKNNCGVMT 542
            |..||.:......:...:|||||.||:|..||..:|.:||||...:|..||..:......||:..
Zfish   401 YRKGVSHPLKIFCNPWMIDHAVLLVGFGQRNGVPFWAIKNSWGEDYGEQGYYYLYRGSGLCGIHK 465

  Fly   543 M 543
            |
Zfish   466 M 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 16/57 (28%)
Peptidase_C1A 331..547 CDD:239068 79/215 (37%)
ctsfNP_001071036.1 CY 34..144 CDD:214484
PTZ00203 143..472 CDD:185513 105/326 (32%)
Inhibitor_I29 175..231 CDD:214853 16/57 (28%)
Peptidase_C1 262..471 CDD:278538 78/214 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.