DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and ctsz

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001006043.1 Gene:ctsz / 450022 ZFINID:ZDB-GENE-041010-139 Length:301 Species:Danio rerio


Alignment Length:254 Identity:75/254 - (29%)
Similarity:113/254 - (44%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 TGKPFPYDVPKYKDEIPDQYDWR-LYGA--VTPVKDQSV---CGSCWSFGTIGHLEGAFFLKN-- 371
            || |.||:....| |:|.::||| :.|.  |:..::|.:   |||||:.|:...|.....:|.  
Zfish    41 TG-PRPYESMNLK-ELPKEWDWRNIKGVNYVSTTRNQHIPQYCGSCWAHGSTSALADRINIKRKA 103

  Fly   372 GGNLVRLSQQALIDCSWAYGNNG-CDGGEDFRVYQWMLQSGGVPTEEEYGPYLGQDGYCHVNNVT 435
            ......||.|.:|||    |:.| |.||:...|::: ..:.|:| :|....|..:|..|...|..
Zfish   104 AWPSAYLSVQNVIDC----GDAGSCSGGDHSGVWEY-AHNKGIP-DETCNNYQAKDQDCKPFNQC 162

  Fly   436 LVAPIKGFVNVTSN-------------DPNAFKLALLKHGPLSVAIDASPKTFSFYSHGVY---- 483
            ......|..|:..|             ..:..|..:...||:|..|.|:.| ...|:.|:|    
Zfish   163 GTCTTFGVCNIVKNFTLWKVGDYGSASGLDKMKAEIYSGGPISCGIMATDK-LDAYTGGLYSEYV 226

  Fly   484 YEPTCKNDVDGLDHAVLAVGYG-SINGEDYWLVKNSWSTYWGNDGY--ILMSAKKNNCG 539
            .||.       ::|.|...|:| ..||.::|:|:|||...||..|:  |:.||.|...|
Zfish   227 QEPY-------INHIVSVAGWGVDENGVEFWVVRNSWGEPWGEKGWLRIVTSAYKGGSG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853
Peptidase_C1A 331..547 CDD:239068 68/238 (29%)
ctszNP_001006043.1 Peptidase_C1A_CathepsinX 54..295 CDD:239149 68/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.