DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 26-29-p and CG11459

DIOPT Version :9

Sequence 1:NP_620470.1 Gene:26-29-p / 39547 FlyBaseID:FBgn0250848 Length:549 Species:Drosophila melanogaster
Sequence 2:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster


Alignment Length:328 Identity:105/328 - (32%)
Similarity:160/328 - (48%) Gaps:44/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DKAFHHFKRKHGVAYHSDTEHEHRKNIFRQNLRYIHSKN----RAKLTYTLAVNHLADKTEEELK 302
            |..:..:|.|:...|.:..:: ||. ::.|.:..:.|.|    :.|:.:.:.:|..:| |::.:.
  Fly    27 DTEWDQYKAKYNKQYRNRDKY-HRA-LYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRIL 88

  Fly   303 ARRGYKSSGIYNTGKPFPYDVP--------KYK--DEIPDQYDWRLYGAVTPVKDQSV-CGSCWS 356
            ..        |.:..|.|.:..        .||  |:|.:..|||.||.::||.||.. |.|||:
  Fly    89 FN--------YRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWA 145

  Fly   357 FGTIGHLEGAFFLKNGGNLVRLSQQALIDCSWAYGNNGCDGGEDFRVYQWM------LQSGGVPT 415
            |.|.|.|| |...|..||||.||.:.|:||. .|.||||.||       |:      .:..|:.|
  Fly   146 FSTSGVLE-AHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGG-------WVSVAFNYTRDHGIAT 201

  Fly   416 EEEYGPYLGQDGYCHVNNVTLVAPIKGFVNVTSNDPNAFKLALLKHGPLSVAIDASPKTFSFYSH 480
            :|.| ||....|.|...:......:.|:|.:.:.|.......:...||::|:||...:.|..||.
  Fly   202 KESY-PYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSG 265

  Fly   481 GVYYEPTCKNDVDGLDHAVLAVGYGS-INGEDYWLVKNSWSTYWGNDGYILMSAKKNN-CGVMTM 543
            ||...|.|::....|.|:||.||:|: ....|||::|||:.|.||..||:.::...|| |||.::
  Fly   266 GVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330

  Fly   544 PTY 546
            |.|
  Fly   331 PQY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
26-29-pNP_620470.1 Inhibitor_I29 245..300 CDD:214853 12/58 (21%)
Peptidase_C1A 331..547 CDD:239068 85/225 (38%)
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 12/57 (21%)
Peptidase_C1A 120..334 CDD:239068 85/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.